10        20        30        40        50        60        70        80        90       100       110       120

                            ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                                                                           

Schizosaccharomyces pombe   ---------------------------------------MTEHHTPKSRILRFLENQYVYLCTLNDYVQLVLRGSPASSYSNICER-------------LRSDVQTSFSIFLHSTVVGFD

Saccharomyces cerevisiae    ------------------------------------------------------------MKILFEFIQDKLDIDLQTNSTYKE--------------NLKCGHFNGLDEILTTCFALPN

Saccharomyces paradoxus     ------------------------------------------------------------MRSLYEFTQDKLNIDLETCIIYQE--------------NFKCGQFNGLDEILTTCFILQN

Saccharomyces mikatae       ------------------------------------------------------------MKSLYDFIQDKLEIELETNITYEE--------------NIESGQFNGLDEILTTCFILQN

Saccharomyces kudriavzevii  ------------------------------------------------------------MKSLYEFIQDKLGTDFESNALNQD--------------NFECGQFNGLDELLTTCFILPN

Saccharomyces bayanus       ------------------------------------------------------------MISLSEFIHDKLNTDLETNALHHD--------------VLKYGQFNGLNELLTTCFILPN

Kluyveromyces lactis        ------------------------------------------------------------MKILVEYLES---LECYETLRKSD--------------ILINADSNGVSNLLLSCFAQVN

Candida albicans 1          ------------------------------------------------------------MTVKVNEKKTLLQYVLDNTSNDVP--------------LLPS-----LKEYMETVLVYKS

Candida albicans 2          ------------------------------------------------------------MTVKVNEKKTLLQYVLDNTSNEVP--------------LLPS-----LKEYMETVLVYQS

Ashbya gossypii             MSFKEKRK--------------------LEATDASSDRKRVRTSRDTLVKRDLLDRCYDKVTTLREYILLKLPPRSRLRRKKVASVGE---------GDDVGELESNLSRLLDTSLVCFD

Aspergillus fumigatus       MGQKRKRPVKDGCAAD-----NSALRRIISASSGSRNHGASARNEKDGHSHPVISLYYRQVVTLRQYLLQQIPVTSKSRRRRIASIRSDPLTQREGDDSPGDRQVQDLASVLDTTLVGVL

Aspergillus clavatus        MGKKRKRPSKDSGAGE-----DLAQKRLAGGPNGVRSHHATDAYEGSGHSHPVISLYYHRVVTLRQYLLQQIPVSSKSRRRRITSVQGATSTEKQKNRGVRGYHAQGLADILDTTLVGVL

Aspergillus nidulans        MGKKRKRPVKEPVKDDPICRAKSSPQQPAGNTARSLSTNRNQAADAGKICHPVISLYYRHVVTLRQYILQRIPRSSRARRRRIAAVGG--HSAARDGLAAVPKNEKDLADLLDTTLVGIL

Neosartorya fischeri        MGKKRKRPIKDGCTAD-----NSAPRRIISTSGGSRNHGASARKEKDGHSHPVISLYYRQVVTLRQYLLQQIPVTSKSRRRRIASIRSDPLTQSQGDDSSGERQVQDLASVLDTTLVGVL

Encephalitozoon cuniculi    ----------------------------------------------------------MKIYKSRQMLELLKSFGFLSLRDFLAAYG-----------------VADLPDIVDRVYVRAS

 

                                    130       140       150       160       170       180       190       200       210       220       230       240

                            ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                                                                           

Schizosaccharomyces pombe   SKP-------------------------DEGVQFSSPKCSQSELIANVVKQMFDESFE---RRRNLLMKGFSMNHEDFR----AMHVNGVQNDLVSTFPNYLISILESKNWQLLLEIIG-

Saccharomyces cerevisiae    SR--------------------------KIALPCLPGDLSHKAVIDHCIIYLLTGEL-----YNNVLTFGYKIARNED-----------VNNSLFCHSANVNVTLLKGAAWKMFHSLVG-

Saccharomyces paradoxus     SR--------------------------KVALPYLPGDLSHKAVIDHCIIYLLTGEF-----YNNVLTFGYKIARNED-----------VDNSLFCHSANVNVTLLKGVPWEMFHSLIG-

Saccharomyces mikatae       SR--------------------------KIALPSVSGDLNHKAIIDHCIVYLLTGEF-----FNNVLTFGYKIAKNED-----------VDNSLFCHSTNVSVTLLKGTAWKMLHNLIG-

Saccharomyces kudriavzevii  SR--------------------------KIALPSISGDLNHKSVVDQCITYLLSGDF-----FNNVLTFGYRIARNEN-----------VNNSLFCHSTNVSVTLLKSTTWRMFHDLIG-

Saccharomyces bayanus       SR--------------------------KIALPSIAGDLNHKSVIDQCIIHLLTGDF-----FNNVLTFGYRIARNEN-----------VDNSLFCHSTNVSATLLKSSTWELLHGLIG-

Kluyveromyces lactis        SKH---------------------CVPPEIEISSTFSSSYHCETIETCILYLLHKNF-----TNNILTYGYQLGKNSD-----------VMTKLFCRSSNISVSVLKCNSWRLFHQLVG-

Candida albicans 1          IKR---------------------------PLPAIRPQESFDEFMKELVTRLVMEK------SNNVIAYGYKTSAMESR----------SIFTTFHSSGNFILTHITSHNWSTIFSLLG-

Candida albicans 2          IKR---------------------------PLPAIRPQESFDEFMKELVTRLVMEK------SNNVIAYGYKTSAMESR----------SIFTTFHSSGNFILTHITSHNWSTIFSLLG-

Ashbya gossypii             NDQQNVKDVDMRKKQLIEFTQKGDESYVSLSDGISGSVFSQDEIMDFVVWLLFQRE--PHARPKHILCDGFQKLAGQN------GQGTTNIPDLSIRHHNSHVKALRESPWPQLLALLG-

Aspergillus fumigatus       NET-SPTVTQERRRDFAAYSQTQSQCRSELTSTDTGPPCSQSEIVDFVITSLFNRNGFSYHRPQHLLAHGYQRAGASERMTDNLAAPTSSIPGLVVRFPNRNVETLKHAPWTNVLALLG-

Aspergillus clavatus        KES-SPTVTQERLRDFASYSQSQSQGRSEVPSTDVGPPCAQSEIVDFVISALFNRHAFSYQKPQHLLTHGFQRAGGPD------VKLASSIPGLARRYPNKNVQCLKQAPWTDVLGLLG-

Aspergillus nidulans        KEL-PPTRSEERRRDFIAFTQAQQTTQT---GTDSGP------IVDFAISSIFNRP--SHGKLENVLSHGYRQG---------GGRLPCSIPNVAAQFPNKNVQMLKQSPWTEVLALLG-

Neosartorya fischeri        NET-SPAVTQERRREFAAYSQTQSQCRSELTSTDTGPPCPQSEIVDFVITSLFNRNGFSYHRPQHLLAHGYQRVGAPERMTDNHAAPTSSIPGLVVRFPNRNVETLKHEPWTNVLALLG-

Encephalitozoon cuniculi    RTP---------------------------VVSSFKSTQKDVELISKAVRTLLIKNR------DNHLCAGYKWWSPGLPG---------ASTKIICYFPNSSSRILRSHEWSWLMRSIGD

 

                                    250       260       270       280       290       300       310       320       330       340       350       360

                            ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                                                                           

Schizosaccharomyces pombe   SDA---MHYLLSKGS--IFEALPNDNYLQISGIPLFKNNVFEET--------------------------------------------------------VSKKRKRTIETSITQNKSAR

Saccharomyces cerevisiae    TYA---FVDLLINY---TVIQFNGQFFTQIVGNRCNEPHLPPK-----------------------------------------------------------------------------

Saccharomyces paradoxus     TNS---FVDLLINY---TVVQFNGQFFAQIVGNRCNEPHLPPK-----------------------------------------------------------------------------

Saccharomyces mikatae       TNA---FVDMLINH---TVIQFNGHFFTQIIGNRCNEPHLPPK-----------------------------------------------------------------------------

Saccharomyces kudriavzevii  TYA---FVDILVNY---TVIQFNGQFFSQIVGNKCNEPHLPPK-----------------------------------------------------------------------------

Saccharomyces bayanus       THA---FVDLLINY---TVVQFNGKFFTQIVGNRCNEPHLPPK-----------------------------------------------------------------------------

Kluyveromyces lactis        TDN---FVNLLINY---SVYFNTGHYFRQIIGTPANAPQVPPA-----------------------------------------------------------------------------

Candida albicans 1          PKK---FLELLVN---------NKGFVSKVNGE--SVQIFGDV-----------------------------------------------------------------------------

Candida albicans 2          PKK---FLELLVN---------NKGFVSKVNGE--SVQIFGDV-----------------------------------------------------------------------------

Ashbya gossypii             KAGEEIMIKLLVDASIYVAVEAGLNNYHQLSGVPLAELD---------------------------------------------LPGGNVSLNKGSAPSDSSNLDAGS------------

Aspergillus fumigatus       GNGEEIMLRLLLDCGIFTAIDHRKGIYYQLSGLPLSSLEPVKR---QLPQEVSDLSGASIKTANNTGGFCSGPQHRKSVRQEVVHKPNSIVFFRRRMLYAKPVLNSKGDVHFGLTRLHVL

Aspergillus clavatus        GNGEEIMLRLLFDCGIFMAIDHRKGIYYQISGLPLSSLEPIQN---QSPLEVPNANSKPSLAAGSN-----VARKNRSSDQGIAHKPNSVVFFRRRMLYAKPILNSRGEVHFGLSALHVL

Aspergillus nidulans        SNGDEIMLKLLLDCGLFMAVDARKGVYCQISGQAISSLKPIDTSPEDCPAAFNGSSSPVKRHAVPWQGAAPRAHTKGPKENQQQLSPNAIIFCRQRMLYARPHLNANGGITFGLPN-HVL

Neosartorya fischeri        GNGEEIMLRLLLDCGIFTAIDHRKGIYYQISGLPLSSLEPVKR---ELPQEVSDLSGASIHTANSTGGFCSGLKKRKSVRQEVVHKPNSIVFFRRRMLYAKPVLNSKGDVHFGLTRLHVL

Encephalitozoon cuniculi    ELAFFILTECLVIQMLNSGYVFLAGDFKSLSGMATER-----------------------------------------------------------------------------------

 

                                    370       380       390       400       410       420       430       440       450       460       470       480

                            ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                                                                           

Schizosaccharomyces pombe   KEVSWNSISISRFSIFYRSSYKKFKQDLYFNLHSICDRNTVHMWLQWIFPRQFGLINAFQVKQLHKVIP--------LVSQSTVVPKRLLKVYPLIEQTAKRLHRISLSKVYNHYCPYID

Saccharomyces cerevisiae    --WAQRSSSSSATAAQIKQLTEPVTNKQFLHKLNINSSSFFPYSKILPSSSSIKKLTDLREAIFP-------------TNLVKIPQRLKIRMNLTLQKLLKRHKRLNYVSILNSICPPLE

Saccharomyces paradoxus     --WAQRTS--SGNTAQIKQLMGPVTNKPFLHRLKINSPSFFPYGKILPLSSSFKKLTDVRETIFP-------------INLVKIPQRLKVRINLTLQKLLKRHKRLNYVSVLNSICSPSE

Saccharomyces mikatae       --WAQRSSPSSGSIAQIEPVMEPVTNKPFLHKLKLNCPFIFPYKTILSLSSSIEKLIELRENIFP-------------SYLVKIPQKLEVQINLTLQKLLIRHKRLSYVSILNGICPRLK

Saccharomyces kudriavzevii  --WAQRASSSSERTVQMKQLTRPVTNKSFLHKLKTNSSTFFPYGRILSSSSSINRLSELREAIFP-------------SNLIKVPQRLKIGIDLTLRKMLTRHKGLNYVSILNNICPPLI

Saccharomyces bayanus       --WVKKSSSPSDTTLLMKQLMEPITNKPFLHRLKINSPNFFPYGRILPSSSTLNKLTELRDAVFP-------------PNLVKIPQSLRIRVNITLQKLLTRHKRLNYVSILNNICPQLK

Kluyveromyces lactis        --WLDRSYRRERNTKLTIDWNSALYHKIRPQDYKN----IIETDQGLLIAEIFPKISESSKTPRS-------------LNFALN------NLKPILYELIRAHERFSYRHIINNICPKSD

Candida albicans 1          --NSHRKAVVVSKYITKFNVLYNSYSRDFSRFEMIRPSIQTILQDILSFSGLNPGRSSKRYRGFK-------------SLLSRIIANDKKCRYDILYAKFIGTSKCNFANVVS-------

Candida albicans 2          --NSHRKAVVVSKYITKFNVLYNSYSRDFSRFEMIRPSIQTILQDILSFSGLNPGRSSKRYRGFK-------------SLLSRIIANDKKCRYDILYAKFIGTSKCNFANVVS-------

Ashbya gossypii             ---------HGVIKIMMYMFPRQFGLHNVFTFQVDHTKTSQKFQDYTSREEEIAPIFQAKPGDAASRKP-------------KIPKRLRGDVEQLVKRLQILHSRCSYTELLSYYCSCVF

Aspergillus fumigatus       NRYPRSDSLSETVHILKYIFPRQYGLHNVFTSVTDSRETVMPFKDYFSRETEIAQMDEQKRKRRQRIGPGFMNHFEKHKDLVEIPKRLRGKAVELVQQLQNRNRRCPYVKLLDYYCPADD

Aspergillus clavatus        NRYPRSDSLSQTVHILKYIFPRQFGLHNVFTSVTDSRETVLPFKDYFSRETEIEEIEEKRRKQRRRIGPEFTNHYQDQKEFIDIPKRLRGKACELVQQLQNRNRRCPYTELLNYYCPPVD

Aspergillus nidulans        SRFHSAKSLQQTVHVMKYVFPRQFGLHNVFTSHSSYYENPLS-KNYSSREEEIARKEGLEAARNQLRKSGFHAAIGERQESIKIPKRLRGKPLELIRQLQNRSRRCCYKKLLQYYCSEEL

Neosartorya fischeri        NCYPRSDSLSETVHILKYIFPRQYGLHNVFTSVTDSRETVLPFKDYFSRETEIAQIDEQKRKRRQRIGPGFTNHFEKHNDLIEIPKRLRGKAVELVQQLQNRNRRCPYVKLLDYYCPIED

Encephalitozoon cuniculi    -------------------VSNAIGRNVLFYKETRRISFCSLSAFEYVFEAHNSEKYKVIQKDAR----------------------------DVLESIERRWKKISTHAIFKSFFKDEL

 

                                    490       500       510       520       530       540       550       560       570       580       590       600

                            ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                                                                           

Schizosaccharomyces pombe   T------------------------------------------------------------------HDDEKILSYSLKPNQVFAFLRSILVRVFPKLIWG----NQRIFEIILKDLETF

Saccharomyces cerevisiae    G-----------------------------------------------------------------TVLDLSHLSRQSPKERVLKFIIVILQKLLPQEMFG----SKKNKGKIIKNLNLL

Saccharomyces paradoxus     E-----------------------------------------------------------------TVSNLSHLSRQSPKEQVLRFIIVILQKLLPQEMFG----SKKNKCKIIRNLNLL

Saccharomyces mikatae       E-----------------------------------------------------------------TTSELPHLSRQSPKEEVLKFVIVILQKLLPQEMFG----SKKNKCKIIKNLNSL

Saccharomyces kudriavzevii  E-----------------------------------------------------------------NGSELSHLGWQLPKEQVLRFLIVILEKLLPKEMFG----SKKNKCKIIRNLNSL

Saccharomyces bayanus       E-----------------------------------------------------------------NASELPHLKSQLPQSQVLKFLIVILQKLLPQEMFG----SKRNKCKIIQNLNSL

Kluyveromyces lactis        --------------------------------------------------------------------------TFYSSPKSVIKLLIVCVRKTFPLDLLG----SNSNYSVLSKAIAIL

Candida albicans 1          ---------------------------------------------------------------------------NKTEISQVIQFVLLVLGKLLPLDAWG----GVSNKKIIKDRVVDF

Candida albicans 2          ---------------------------------------------------------------------------NKTEISQVIQFVLLVLGKLLPLDAWG----GVSNKKIIKDRVVDF

Ashbya gossypii             DRPSQIRKPKAKKIPMSTRKPKPSQHPFS--RSNQKCVSSQMHPEAGTSG-----------TQVQSLPEHDSLVELATPSFQVSSFCRAVLSKIIPDSFWGDKDAGKHNKSIAMRNVDHF

Aspergillus fumigatus       VWPWKLSHTNSQEGSTGEEPRTPSDRLVTQPRGAEQHAARDVGPKESPKIRYSTHDTEDGTTKCLVPEPKQNLMDYATPSSSVSAFCRAVLRKLIPPQFYGIGQYQKSNQEIIFSHVDRF

Aspergillus clavatus        TGPWKLGPTDSQTSHPSG--TAISESLVTQRRGPQGSFAHAS-PLSHLQETPSVATFKAEATVSKILKPKLCLIDYATPCSSVSAFCRAALRKLVPPRFYGTGCHQRSNQDIVFRHVDRF

Aspergillus nidulans        SGPWILGQLSAESNSVLS--TSSSRPLVTQPSLAHQDMQRELRPTSYAKG---------FSKGSGATKPKENLTDHATPAASVSAFCRAVIRNLIPLEFFGVGEQGITHQKMILGHVDRF

Neosartorya fischeri        VGPWKLGHTNSQEGSTGKGSCTASDQLVTQPRGAQQHAARDMGPKESLRTRNSIHDTEKGITKCVIPEPKQSLMDYATPSSSVSAFCRAVLRKLIPPQFYGIGQYQKSNQEIVFSHVDRF

Encephalitozoon cuniculi    AIE-----------------------------------------------------------------DKSSALECGVKQSKLVNFLFLISKKLFKDAFDL------HGFRILKSRLSLL

 

                                    610       620       630       640       650       660       670       680       690       700       710       720

                            ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                             |-----------------------Motif T-----------------|         |--

Schizosaccharomyces pombe   LKLSRYESFSLHYLMSNIKISEIEWLVLGKR------SNAKMCLSDFEKRKQIFAEFIYWLYNSFIIPILQSFFYITESSDLRN-RTVYFRKDIWKLLCRPFITSMKMEAFEKIN-ENNV

Saccharomyces cerevisiae    LSLPLNGYLPFDSLLKKLRLKDFRWLFISDI---------WFTKHNFENLNQLAICFISWLFRQLIPKIIQTFFYCTEISSTVT--IVYFRHDTWNKLITPFIVEYFKTYLVENN-VCRN

Saccharomyces paradoxus     LSLPLNGYLPFDSLLKKLRLKDFRWLLVSDV---------SFTKQNFENLNQLVTCFISWLFRHLFPKIIQTFFYCTEISSTVT--IVYFRHDIWNKLVTPFLAGYFKKYLVENN-VCRN

Saccharomyces mikatae       LSLPLNGYLPFDSLLKKLKFKDFRWLMVSTI---------SFTRQNFENLNQMVICFVSWLFRQLLPKVIQTFFYCTEISSTVK--IVYFRHDVWNGLVSPFLTGYFKRYLVENN-VCRN

Saccharomyces kudriavzevii  LSLPLHGCLPFNSLMKNLRLKDFKWLLVSDS---------SFTKQNFENSNQLVIYFVSWLFRQLIPKIIQTFFYCTEISSTVA--IVFFRHDILDKLVAPFLREYFEKYLIENS-ICRN

Saccharomyces bayanus       LGLPLNGHLLFGDLLKKLRLKDFQWLMVSDV---------SFTKQNFENSNLLMTFFVSWLFRHLVPKIIQTFFYCTEISSTVT--IIFFRHDTWNKLVTPFLAEYSEKYLTENI-VCRN

Kluyveromyces lactis        VKKPLHSKILFDELCKGLRVKDVKWLETRRLPAGEQT--QKIPYYDVKNRQALLYKLFFWILSCYVPKLLSTFFYVTELSSTVD--IVYIRHDTWKTMSQPFLKSYFRRYLLENK-YCFQ

Candida albicans 1          LLLGANEKIHMDDLFRGIRLKDFKWLGRAHQ---------ISSKQDFELRTAFLKGYLWWLFEHLLKNILRSFWYITETSSIVSSELNYFPQYLWKELYESWVSKYAKNNLVKMP-SKIQ

Candida albicans 2          LLLGANEKIHMDDLFRGIRLKDFKWLGRAHQ---------ISSKQDFELRTAFLKGYLWWLFEHLLKNILRSFWYITETSSIVSLELNYFPQYLWKELYESWVSKYAKNNLVKMP-SKIQ

Ashbya gossypii             IRLRRFETMSLHELTQDLKIAEISWL------QPHNTGTQKPSRTDTEKRLEIFHEFLYFVFDSLLIPLIRNNFYVTESNTHRY-RVFYFRHEVWRRIAEPAMADLKADMFEEVKLDDAL

Aspergillus fumigatus       IRMRRFESLSLHEVCKGIKITSIPWLDYSRHQHQESLPGRKLSLSDLHKRTELLHEFIYYIFDSILIPLIRSNFYVTESQIYRN-QLFYFRHDVWRHLTLQPLATFKTTLFEEMKRADAE

Aspergillus clavatus        VRMRRFESLSLHEVCKGIKITCMPWLGHPANQQDEGSSQPKMSLSDLRKRTELLHEFIYYIFESILVPLIRSNFYVTESQSHRN-RLFYFRHDVWRQLTQQPLAEFKTSLFEEMKRGVAE

Aspergillus nidulans        IRMRRFESLSLHEVCEGIKPE----------SLRQAPSENNISASDLQKRRELFHEFLYYLFDSILLPLIRGSFYVTESQVHRY-RLFYFRHDVWRRLTAQPLAHLRASIFEELAPETAE

Neosartorya fischeri        IRMRRFESLSLHEVCKGIKITSIPWL-----EHQESLPGRKLSLSDLHKRTELLHEFIYYIFDSILVPLIRSNFYVTESQIYRN-QLFYFRHDVWRHLTLQPLATFKATLFEEMKRADAE

Encephalitozoon cuniculi    IHRNRYETVSKNELVKYFRISRFKFFR-----------TLRCTRSEFVFRFRVSSRFLVYITEKLIIPIISKYFYCTETSFSKF-KVHYFPRSIWRHFSSIHIDRFLEKFEPAKG-----

 

                                    730       740       750       760       770       780       790       800       810       820       830       840

                            ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                  ------Motif 1---------| |-----------Motif 2-------------------|                                               |---------

Schizosaccharomyces pombe   RMDTQKTTLPPAVIRLLPKKNT--FRLITNLRKRFLIK---------QMGSNKKMLVSTNQTLRPVAS-------ILKHLINEESSGIPFNLEVYMKLLTFKKDLLKHRMFG---RKKYF

Saccharomyces cerevisiae    HNSYTLSNFNHSKMRIIPKKSNNEFRIIAIPCRG------------ADEEEFTIYKENHKNAIQPT----QKILEYLRNKRPTSFTKIYSPTQIADRIKEFKQRLLKKFNN--ALPELYF

Saccharomyces paradoxus     HNSYTLSNFNHSKMRIIPKKNNNEFRIIAIPCGG------------ADEEEFMIYKENHKNAVAPT----QKVLEYLRNKRQTSFTKMYSPMQIADRIKEFKQSLLKKFNN--VLPELYF

Saccharomyces mikatae       HNSYTLSNFNHSRMRVIPKKSNNEFRIIAIPCGG------------ADDEEYMIYKENHKNAVAPT----QKILEYLRNKRLTSFTKIYSPTQIADRIKEFKLSLLKKFNN--VLPELYF

Saccharomyces kudriavzevii  HNSYTLSNFNHCRMRIIPKKSNNEFRIIAIPCEG------------ADEEEFMVYKENHKRVIAPT----QKILEYLRNKRPTDFVKIYSPTQIADRIKEFKQGLLKKFNN--VLPELYF

Saccharomyces bayanus       HNSYTLSNFNHSRMRIIPKKSNNEFRIIAIPCRG------------ADEEEFAVYKENHKKAVTPT----QKILEYLRKKRPTSFTKIYSPTQISDHIEKFKQILLKKFDN--ILPALYF

Kluyveromyces lactis        HRSFTESKFNHRNLRLIPKKSGLDFRIIAVPCKG------------VNIQEFNEFNDYVTNALKPT----KIILERLRMRRNTKFTKAFSPLEIPKIVLSYKQRLLLKHG---KIPNLYL

Candida albicans 1          R-----EQLPCGKIKLIPKRSS--FRVICVPIKRSLKLLNKKLELDTLEKEKREFERYRKEVLSPVGQILRLKLSKLRDTYESYRASVHSSSDVAEKISDYRDSLLTRFG---EIPKLFI

Candida albicans 2          R-----EQLPCGKIKLIPKRSS--FRVICVPIKRSLKLLNKKLELDTLEKEKREFERYRKEVLSPVGQILRLKLSKLRDTYESYRASVHSSSDVAEKISDYRDSLLTRFG---EIPKLFI

Ashbya gossypii             QILESR-DLGSSQIRLLPKGNR--LRPIMNLRRRAMAR----------G-QSRKLGLSINTVLGPIHS---LLKLER----------------------AFKGTLGPD------PGKLYF

Aspergillus fumigatus       RRLCGR-SLGYSSLRLLPKTTG--VRPILNLRRRNLQP-------GWAG-KAPFLGPSINSTMTPIFN---VLKYETARNPASLGSTLSFVGEIHTRLKSFKERLSQS-HSSDRRKRLYF

Aspergillus clavatus        RRLSSR-SLGYSSLRLLPKTTG--VRPILNLRRRMLKP-------GWAG-KAPFLGPSINSTIAPVFN---VLNYEKRRNPDSLGAALSFVGEIHTRLKGFKERLTQK-HAGHPRPHLYF

Aspergillus nidulans        KLLSGKKSIGYGSLRLLPKTTG--IRPILNLRRRTLVRS------IYAGKNRYHPAQSVNSAIAPVYS---MLNYERGRRNDLLGSSMFSVGDMHSRLKKFKESLMSR--GWDQRKRLYF

Neosartorya fischeri        RRLGGR-SLGYSSLRLLPKTTG--VRPILNLRRRMLQP-------GWAG-KAPFLGPSINSTITPIFN---VLNYEKARNPASLGSTLSFVGEIHTRLKSFKERLSQS-HSSDRRQPLYF

Encephalitozoon cuniculi    -----STTHSYSELRCIPKMNG--ARIISNMSKAR------------------NGRPSINKSIYPEFC------VLRHETHGMLGNSILNHSGMYEKLSSYLSRSVRP---------LYI

 

                                    850       860       870       880       890       900       910       920       930       940       950       960

                            ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                  --Motif A-----------------|                                                                                              

Schizosaccharomyces pombe   VRIDIKSCYDRIKQDLMFRIVKKKLKDPEFVIRKYATIHATS-----DRATKNFVSEAFSYFDMVP---------FEKVVQLLSMKTSDTLFVDFVDYWTKSSSEIFKMLKEHLSGHIVK

Saccharomyces cerevisiae    MKFDVKSCYDSIPRMECMRILKDALKNENG---FFVRS----------QYFFNTNTGVLKLFN---------------VVNASRVPKPYELYIDNVRTVHLSNQDVINVVEMEIFKTALW

Saccharomyces paradoxus     MKFDVKSCYDSIPRMECMRILKEALKSENG---FFVRS----------QSFFNTNTGVLKLVN---------------VVNASRVPKPYELYIDNVRTIHLSNQDVINVVEMEIFKTALW

Saccharomyces mikatae       MKFDVESCYDSIPRIECMRIIKRALKSENG---FFVRS----------QYISNTNTGALKLVN---------------VVNASRTPKPYELYIDNVRTVHLSNQDVINVIEMEIFKTALW

Saccharomyces kudriavzevii  MKFDVKSCYDSIPRTECMRIIKRALKKENG---FFVRS----------QSFFNTNTGILKLTN---------------VVNASRTPKPYELYIDNVRTVHLSNQDVIDVIEMETFKTALW

Saccharomyces bayanus       MKFDVKSCYDSIPRTKSMQIIKRALENENG---FFVRS----------QSFFNTNTGVLRLVD---------------VVNASRTPKPHELYIDNVRTVHLSNQDVINVIEMEMFKTSLW

Kluyveromyces lactis        LKFDIQSCYDSIPVQKVMKLVEARICEEQQ---FFIRS----------QDILTTASTRLKRLH---------------AVNGDIQFQENDLVIDSVKTTVLSKEDVLTVVKMELFKTSIF

Candida albicans 1          LKFDMKECYDRLSQPVLMKKLEELFENQDNKTSYYVRYYAQLDASHKLKKVKTTIDTQYHNLN---------------ILSSSRHLSNCKSLVDKTKTIALQKGNILEVCRSQIYDVVGS

Candida albicans 2          LKFDMKECYDRLSQPVLMKKLEELFENQDNKTSYYVRYYAQLDASHKLKKVKTTIDTQYHNLN---------------ILSSSRHLSNCKSLVDKTKTIALQKGNILEVCRSQIYDVVGS

Ashbya gossypii             AKTDVKAAFDTIPQEAVVELMKSVPSQTNYTIMKHVEVKPGE---RAVIDDDKYSSKAIRRWHATALSENESSVFVERLEKDLAPKKKNTVFVDSAFRRTKNVGELMHLLRQHVEQNLVL

Aspergillus fumigatus       VKLDIQSCFDTIPQKELIPLVESLFSEEGYQIGKHVEVRPPDEFSSMWPVQESQQSKALRKYVGRAAPVSKAQALTDAITDGGISHRRNTVFVDTPAHKEYSGDYLLDLLDEHIRYNLVK

Aspergillus clavatus        VKVDIQSCFDTIPQENLVPLVESLVSEEGYYVAKHVEVRPSDEFSSMWPLHESQQSKALRKYVGRAAPVTNSQDLTEAIAEGGISHRRNTVFVDTVAHKEYSGDYLLDLLDEHIRYNLVR

Aspergillus nidulans        VKLDIQSCFDTIPQAKIVRLVEKLVSEENYHWMKYVEMRLASEFDNMWPLRKPQQRRTWSKYLQRVGPVGRPENLADAIANGSVVGRRNTVLVDTIAQKEYNGEGLLDILNEHIRNNLVK

Neosartorya fischeri        VKLDIQSCFDTIPQEELIPLIESLFSEEGYQIGKHVEVRPPDEFSSMWPVQESQQSKALRKYVGRAAPVSRAQDLTDAITDGGISHRRNTVFVDTPAHKEYSGDYLLDLLDEHIRYNLVK

Encephalitozoon cuniculi    LKVDLSGCFDNIPQDEVVSLVRRLLHKSRYHTKSFSILEEVG--GELRSRYVCKVTENAETIN---------------ELMMEPGAFVNKVVKENASQRILSREEVEGAMTNMIKRNYVK

 

                                    970       980       990       1000      1010      1020      1030      1040      1050      1060      1070      1080

                            ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                     |------------Motif B'------------------|        |----Motif C----||------Motif D------------|                 |-Motif  

Schizosaccharomyces pombe   IGNS-----QYLQKVGIPQGSILSSFLCHFYMEDLIDEYLSFTKKK--GSVLLRVVDDFLFITVNKKDAKKFLNLSLRG-FEKHNFSTSLEKTVINFENSNGIINNTFFNESKKRMPFFG

Saccharomyces cerevisiae    VEDK-----CYIREDGLFQGSSLSAPIVDLVYDDLLEFYSEFKASPSQDTLILKLADDFLIISTDRQQVINIKKLAMGG-FQKYNAKANRDKILAVSSQSDDDTVIQ----------FCA

Saccharomyces paradoxus     VEDK-----CYLREDGLFQGSSLSAPIVDLMYDDLLEFYGEFKTCPNQDTLILRLADDFLIISTDQQQIINIKNLASGG-FQKYNAKANEDKILAVSSHSDDDTVIQ----------FCA

Saccharomyces mikatae       VQDK-----CYLREEGLFQGSCLSAPIVDLVYDDLLEFYDEFKSSSNQDTLILKLADDFLIISTDQQQIINVKKLAMDG-FEKYNAKVNRDKILSVCSPSDSGTVIQ----------FCA

Saccharomyces kudriavzevii  VQDK-----CYLREDGLFQGSSLSAPIVDLVYDDLLEFYDEFKASPNQDTLILRLADDFLVISTDQQQISRIKKLAMGG-FEKYNAKANEDKIITVCSQPNNDTVIQ----------FCA

Saccharomyces bayanus       IQDK-----CYLREDGLFQGSSLSAQIVDLVYDDLLESYNEFKASPNQDTLILRIADDFLIISTDQQQIIDIKNLATCG-FEEYNAKANEDKIITVSSQSNNDTIIQ----------FCA

Kluyveromyces lactis        YRGK-----CYLRKDGLFQGTPLSSVLVDILYDDLLEFYTEFTDENDSDPMIIRLVDDFLIVSTSKKYIERLNNLAQTG-FKSFNTYINPQKVLVTSSESETSTNVP----------FCA

Candida albicans 1          VKDARGNLHLYKRKRGVFQGFSLSSIFCDILYSAMVHDCFQFLWKSKQDFLFVRLVDDFLLVTPDSNIYDQVHNILSGKILESYGAFVNKDKTVVVN-QTTTKTSID----------FVG

Candida albicans 2          VKDARGNLHLYKRKRGVFQGFSLSSIFCDILYSAMVHDCFQFLWKSKQDFLFVRLVDDFLLVTPDSNIYDQVHNILSGKILESYGAFVNKDKTVVVN-QTTTKPSID----------FVG

Ashbya gossypii             VGKK-----YYRQKVGIPQGSVLSSFLCNYFYADLEAKHLGFLDSP--DCLLLRLIDDFLLVTLDQNKAAKFVNAMHGG-FPEYGVAVNPAKTMVNFDMLYAGEPVRNYNHEK-GFPYCG

Aspergillus fumigatus       VGRK-----YFRQRNGIPQGSILSSVLCNLFYAQMERESLSFLDPS--EAVLLRLVDDFLLITINSNLAMRFLQVMLKG-QPKYGISINPAKSLVNFSAMVDGVQIPRLEGSH-LFPYCG

Aspergillus clavatus        VGKK-----YFRQRNGIPQGSILSGVLCNLFYARMERECLGFLQSD--ESVLLRLIDDFLLVTTDSSLAMRFLQVMLKG-QPEYGITVNPAKSLVNFAAAVDGVQIPRLVDSA-LFPYCG

Aspergillus nidulans        IGKK-----YFRQRKGIPQGSVL