10        20        30        40        50        60        70        80        90       100       110       120

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                                                                       

Cryptosporidium parvum   MSVLKGALAVLMKQEVLTLGEYLEQKRKIRVFKEEGLYNDSSGELRRLLEETLILEDPSIPKALKEGFLGLRELTFNSLDNSLDINGDRRKLLGINIEKLLEWSSILGQNYFSSPRNQSS

Cryptosporidium hominis  MSVLKGALAVLMKQEVLTLGEYLEQKRKIRVFKEEGLYNDSLGELRRLLEKTLILEDPFMPKALKEGFLGLRELTFNSLDNSLDINGDRRKLFGINIEKLLEWSSILGQNYFSSPRNQSS

Giardia lamblia          ------------------------------------------------------------------------------------------------------------------------

Giardia intestinalis     ------------------------------------------------------------------------------------------------------------------------

Leishmania amazonensis   -----------------------------------------------------------------------------------------MSASFPSIPGFAGPLSLKAFLEEYFGLHLTF

Leishmania infantum      -----------------------------------------------------------------------------------------MSASFPSIPGFAGPLSLKAFLEEYFGLHLTF

Trypanosoma brucei       -----------------------------------------------------------------------------------------MAQMFPSVPGYDGPFSLKDFLHNYIGLQLRW

                                                                                                                                                 

 

                                 130       140       150       160       170       180       190       200       210       220       230       240

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                   |-------------------------------------------------------------------------------------------------Mo

Cryptosporidium parvum   MSSGKRSRNTEYNETLSPSFITD-QIKNIIPDSEKDS-----------------------------------------------------LTYQVQDFELLLRK--HFPRIRIFHS-GSY

Cryptosporidium hominis  MSSGKRSRNNEYNETLPPSFITD-QIKNIIPDSEKDS-----------------------------------------------------PTYQVQDFELLLRK--HFPRIRIFHS-GSY

Giardia lamblia          --------------------MDFPLSLLDANVSKAIF-----------------------------------------------------ILLQGEPEQASLWS--LILQLRTPGQ-GSS

Giardia intestinalis     --------------------MDFPLSLLDANVSKAIF-----------------------------------------------------ILLQGEPEQASLWS--LILQLRTPGQ-GSS

Leishmania amazonensis   AAETASPSPRAAATAETPSAAG-FRALRDVVLPPNQSFLVVVYVALHASSSPPPTTAHASPTPATPDPGCAAPPTGLGRLRQPLAHQTAVSTAHDTCVTRCNPSDRQNPFCLSSSSTGKN

Leishmania infantum      AVETASPSPRAAAAAEAPSAAG-FRALRDVVLPPNQSFLVVVYVALHASSSPPPTTAHASPTPPTPAPGCAASATGFGRLRQPLTHQTAASTAHDTYVARCSPADRPNSSCSSSSSTGKN

Trypanosoma brucei       STPQENSTTLPPSNSN-----------VVVVPPTGNFHVVVYVSRSAPPP----------------------------------QRSVRSVAVLSSC----------------------S

                                                                                                                                                 

 

                                 250       260       270       280       290       300       310       320       330       340       350       360

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures               tif GQ--------------------------------------------------------------------------------------------|                     

Cryptosporidium parvum   SGLRTSFDTIKPKKYSFCN---STLYKFQ-NLHAWNT-----LLSKI-GPIEILFLFVCCIIFRILGDHSE-ILIQQAGRMLTNDFLEELARLYETGPK--KTNSFVSSSSLTPILTIEE

Cryptosporidium hominis  SGLRTSFDTIKHKKYSFCN---STSYKFQ-NLHAWNT-----LLSKI-GPIEILFLFVCCIIFRILGDHSE-ILIQQAGRMLTNDFLEELARLYETGPK--KTNSFVSSSSLTPILTIEE

Giardia lamblia          FASCA-----------------SLIYKDLKGLSSWIT-----EAAFI-PFLRRLGFCSLYLSYG---HDVL-LELFKYPIVLTSTVSGKRVLLSEPQMP---------------------

Giardia intestinalis     FASCA-----------------SLIYKDLKGLSSWIT-----EAAFI-PFLRRLGFCSLYLSYG---HDVL-LELFKYPIVLTSTVSGKRVLLSEPQMP---------------------

Leishmania amazonensis   GNARSPWCASASWLLYTNTSHRPFTDALLRHP--WRASFSACLGPAAMGFIE-MY----CPIVLQLEAMAGGVQVIGPALKHVALETSFSATAQLSEMKGLPPRGSASVSSRGVKRAVDT

Leishmania infantum      GNARGLWRSSAFWLLYTNTSHRPLTDALLRHP--WWASFAACLGPAAMGFIE-MY----CPIVLQLEAMAGGVQVLGPALKHAALETSFSATAPSSEMKGPPPQGSGYVSSRGVKRAVDT

Trypanosoma brucei       NKMDG---DHPQPSVPTHFHGRPLTSSVLKHP--FWDALFSQIGPTAVSFIV-LW----APIVVQFEASGGGLQVLGPPLKR-----------------SASCAVKRQPGAG--------

                                                                                                                                                 

 

                                 370       380       390       400       410       420       430       440       450       460       470       480

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                                                                       

Cryptosporidium parvum   KEEVKPLDETPRQVNKRSGGIIKDSRLSKIYKIDIPYRSTFLYCDHFSKRGGLPCLSVLRLLPPNLLGARTLLRFIIQTDHIFKDHNRQSLIGLLGSYEMTKFSRVKCKLASAMMEEFQN

Cryptosporidium hominis  KEEVKPLDETPRQVNKRSGGIIKDSRLSKIYKIDIPYRSTFLYCDHFSKRGGLPCLSVLRLLPPNLLGARTLLRFIIQTDHIFKDHNRQSLIGLLGSYEMTKFSRVKCKLASAMMEEFQN

Giardia lamblia          ---------------------------------------------------------------LAFPPCLHDKSVSSMVRASTVQYASNCLEEFISMIQEHPMNVRFIFFCKTRPYIRAF

Giardia intestinalis     ---------------------------------------------------------------LAFPPCLHDKSVSSMVRASTVQYASNCLEEFISMIQEHPMKLRFIFFCKTRPYIRAF

Leishmania amazonensis   GE-CSAPLPLQKQRRVEAVASPPKAGRRLQREVAPSHRPCRDDSFSSPVNRAAMPATWAAALTRTDDPRTRLYSVRVSDSDCTGDG-GGALPLPAGSLEAHWLPRHPRSLHRVLQAALPK

Leishmania infantum      GE-CSGFLPLQKQRRVEAPP-KAKAGRRLQRGVVPCSRPRRDDPFASPVNRAAMPVTWAAALTRTDVPRTRLYSVRVSDSDGAGDGSGGALPLPAGFLEAQWLRRHPHSLHRVLQAALPK

Trypanosoma brucei       ---WWEGKLKVSRTETLTQND---------------------------PHCFCIEGTSSPVALYRLNVPRLHLVEQSPLRST------ADARHAVTLILEQLWIEHHKSSCSPSSDRDIS

                                                                                                                                                 

 

                                 490       500       510       520       530       540       550       560       570       580       590       600

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                                |--------------Motif CP---------- -----

Cryptosporidium parvum   L--------------------------------------------------------------------------------LLNI------------RN-TSP-VN-FLD---QI-CPIE

Cryptosporidium hominis  L--------------------------------------------------------------------------------LLNI------------RN-TSP-VD-FLG---QI-CPIE

Giardia lamblia          HSLALLGSATAIWHLSLLPSQCLTAFYQANPLVTFKFPYNAFSTRSFSSLLQLCTSRGRLMPNNAINSNAKARITRLISIFRSKM------------KR-LSHNLT-FL----KD-KKPQ

Giardia intestinalis     HSLALLGSATAIWHLSLLPSQCLTAFYQANPLVTFKFPYNAFSTRSFSSLLQLCTSRGRLMPNNAINSNAKARITRLISIFRSKM------------KR-LSHNLT-FL----KD-KKPQ

Leishmania amazonensis   RAAYGASTRHYCAGTGERGTGCTSVKNISMWHVAHVFRWLV----------------------------------------LQPSQSGEVAFQTTSPKFDLPSYLRRFLSTDVDQ-CSRL

Leishmania infantum      RVAYGASARRYSVGASERVTGCTSVEDIPMWHVAHVFRWLV----------------------------------------LQPPQSGADASPTTPPKFDLPSYLRRLLSTVVDQ-CSRL

Trypanosoma brucei       QRLCG------VATGSATNCCGDSCVVLAQARNQVNAV-------------------------------------------FPYTL-LPVHDDAVSGNGTVKEYLIHVLHCALGSVC-RM

                                                                                                                                                 

 

                                 610       620       630       640       650       660       670       680       690       700       710       720

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures               |                                                    |--------------------------Motif QFP-------------------------------

Cryptosporidium parvum   PIKDSDLQNFNKL----------------------------------------PIPCFETSSTRVVNF-------LRLYLIKVLPKNILGTFKNFKTFINKKIPIIVNLHIRETFKIQHA

Cryptosporidium hominis  PIRDSDLQNFNKL----------------------------------------PIPCFETSSTRVVNF-------LRLYLIKVLPKNILGTFKNFKTFINKKIPIIVNLHIRETFKIQHA

Giardia lamblia          SLLQSFGFDTHFRVFLDE-----------TGTL--------------------RHAPLPLSVHKITLY-------LMLYCKSISAFSILG-KRNARTFH-SHLFRFISQPMNGFMTLQEL

Giardia intestinalis     SLLQSFGFDTHFRVFLDE-----------TGTL--------------------RHAPLPLSVHKITLY-------LMLYCKSISAFSILG-KRNARTFH-SHLFRFISQPMNGFMTLQEL

Leishmania amazonensis   DLRGAALRHTGYLEEAFR--------RQQQGVEPWDVQRL---STPVDVVVS--YLRTLLPTLRWAPL-------KEANNGLFWGRDAAGSERVLDALM-RAVRGWLIAGRQAVVPVSRF

Leishmania infantum      DLRGAALKHTGYLEEAFR--------RQQQGVEPWDVQRL---STPVDVVVS--YLRTLLSTLRWAPL-------KEAKNRSFWGRDAAGSERVLDALM-GAVRNWLIAGRHAIVPVSRF

Trypanosoma brucei       NIRGAAIKHTEFLEKRGKSVTSISQKAQTAGQENKMRAIPVGELTVPEPVVAS-YLETLFNMMWWRVPPRFVGGAVTADRVKFWGEEGT----VLTRLR-EVTVDWLCCGRHEVFLLSHF

                                                                                                                                                 

 

                                 730       740       750       760       770       780       790       800       810       820       830       840

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures               ------------|                                                     |----------------------Motif T------------------------

Cryptosporidium parvum   MNGIEVSN--WVNRILEEKSYQFIKESKNLINSNQRSKKVPNNKTRSSIKKSLISLGKTYLARNIYFL-IVYLVFP-----ILRRHF----YATEIE-GSNKV-----RYFRHPVWIKIV

Cryptosporidium hominis  MNGIEVSN--WVNRILEEKSYQFIKESKNLINSNQRSKKVPNNKTRSSIKKSLISLGKTYLARNMYFL-IVYLVFP-----ILRRHF----YATEIE-GSNKV-----RYFRHPVWIKIV

Giardia lamblia          TSSISTKEF--L-LPATTVSKAEGEVRHHLLAYFVV------------------------------YL-MDFVILP-----ALYQSFSAVSMHTELSNRIETANSMVPALLSRSLWVSYK

Giardia intestinalis     TSSISTKEF--L-LPATTVSKAEGEVRHHLLAYFVV------------------------------YL-MDFVILP-----ALYQSFSAVSMHTELSNRIETANSMVPALLSRSLWVSYK

Leishmania amazonensis   LDGVPVAQVPWL-NGFYTTTPSLPFSDATSSASRHARRERSQVQQRV-------------------WLQFVLFLTQDILPFLLRASF----TITWSSKNTHKL-----LFFPAFVWRRLV

Leishmania infantum      LDGVPVAQVPWL-NGFYTTTPSLPFSAATSSAARHARRERSHVQQRV-------------------WLQFVLFLTQDILPFLLRASF----TITWSSKNTHKL-----LFFPAFVWRRLI

Trypanosoma brucei       LDGVPVSRIPWL-RGFYTKEP-----------ARKRRSMIQQRV----------------------FLQLVLFLYQCVVPFLIRRSF----HVACTSKSPYIF----FFIPRAVWVRLTR

                                                                                                                                                 

 

                                 850       860       870       880       890       900       910       920       930       940       950       960

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures               --------|                                                                                            |--1-||---2--|     

Cryptosporidium parvum   RQADKWYLESILKGIQSKDYIMNLSSIQEISKLIDKNSEFSENIPK-------------------------------------------------------IRWVPKSKGLRPLINLSKV

Cryptosporidium hominis  RQADKWYLESILKGIQSKDYIMNLSSIQEISKLIDKNSEFSENIPK-------------------------------------------------------IRWIPKSKGLRPLINLSKV

Giardia lamblia          NYLIKSSARLEIAATYEFVCSLSNLHSIPLTNEDAVNRIFWKQVSPGR-----------------------------------------------------LSFVYKSNGRVRPLCNFSF

Giardia intestinalis     NYLIKSSARLEIAATYEFVCSLSNLHSIPLTNEDAVNRIFWKQVSPGR-----------------------------------------------------LSFVYKSNGRVRPLCNFSF

Leishmania amazonensis   RREVRRTRSCHAPRSQMSLAEERTRMSGADHAALVSAPNACGGAVAAAFPSPHSAASNASAAISAPRDEWRAVRTGGALAHWSARATLATRGGGASCLYAGVRFRPDRRKLRPIAVVRSA

Leishmania infantum      RREVRRTRSCGAPRSQMPLAGESARSVGAERVALSSAPCACEGAATAALPTPHSAASKASAAISAPRDVWRAVRTDGVLAHRGARATLATRGGGASCLYASVRFRPDRRKLRPIAVVRSA

Trypanosoma brucei       REMRRVCIRRVKRMRSDTLSDPQMRGHAGLPPMALERVTSEGLMQLIGPSSQPVGDDS----------GGVSDVCKLRDSSSPLLYSD-------------VRFLVDGSKLRPIARPRFG

                                                                                                                                                 

 

                                 970       980       990       1000      1010      1020      1030      1040      1050      1060      1070      1080

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                                                                       

Cryptosporidium parvum   GSGQILQQNLERDHTCEEKKKIGFCDCNSVWTGGDLPTSWINNNYYYNYFNSNGNNGIVGNNHNYGHINNIGGKNFTSFSSQNCQIMTPPGRLGVGLGFGNYNIGIGINSGSSVPTTPIN

Cryptosporidium hominis  GSGQILQQNLERDHTCEEKKKIGFCDCNSVWTGGDLPTSWINNNYYYNYYNSNGNNGTVGNNHNYGHINNIGGKNFTSFSSQNCQIMTPPGRLGVGLGFGNYNIGIGINSGSSVPTTPIN

Giardia lamblia          CSRRHRVS----LNSFLRSALQVIIFELERP-------------RNRYLQAHLAKNLGHIAVDY-----------AAWLDATY------TENPE--------------------------

Giardia intestinalis     CSRRHRVS----LNSFLRSALQVIIFELERP-------------RNRYLQAHLAKNLGHIAVDY-----------AAWLDATY------TENPE--------------------------

Leishmania amazonensis   SLRSLKEMARGSPSPYSHASAIVRLLRRLGCSDADGQLPAATATLLRQVQARSRHNRRTGVHRSAHPLPPHLPHKAALQDALRCLVSGVEEQRVRDGLPRLSNLSHQDEYAELRSFCEEV

Leishmania infantum      SLRSLKEMARGSPSPYSHASAIVRLLCRLGCSDTDGQLPAATATLLRRVQARSRHNHHTGVHRFPHPLPPHLPHKAALRDALRCLVSGVEEQRVRDGLPRLSNLSHQDEYAELRSFCEEV

Trypanosoma brucei       WQRSLLKAADG---------------------------VGSSTLASALAKAGKYLATDGKAMWPS-------PNSAVLRDALRCLDAGVEER----------RITTGARQRAIGSHNDEY

                                                                                                                                                 

 

                                 1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                                    |--------------Motif A-------------

Cryptosporidium parvum   KVMRRPSSNRIIDIRRPSTNNMLFYPSKILRSFLLRMTGKNHLGASLVQFGDIYKIIKNWWIKNRRDKQQFQMNEDFYQNQGKKMSHVK---IYIIKADLVNCFENINKSKIFEFLD-VI

Cryptosporidium hominis  KVMRRPSSNRIIDIRRPSTNNMLFYPSKILRSFLLRMTGKNHLGASLVQFGDIYKIIKNWWIKNRRDKQQFQMNEDFYQNQGKKMSHVK---IYIIKADLVNCFENINKSKIFEFLD-VI

Giardia lamblia          ------------------------------------------------------------------------------------------AQIYMVTTDMITAFESVSVPRLLYYISHYI

Giardia intestinalis     ------------------------------------------------------------------------------------------AQIYMVTTDMITAFESVSVPRLLYYISHYI

Leishmania amazonensis   RGRHAIPCEGPAKTTPAVSSASPPGA-----------------------------------------------------------TACFAPYVTLLRSDASRCYDNLPQGRVLAAVRSLV

Leishmania infantum      RRRPALPCEGPAGTAPVVSSASPPSAA----------------------------------------------------------ACCFAPYVTLVRSDASRCYDNLPQERVLAAVASLV

Trypanosoma brucei       IEVRSFIQCARQFCTIPTLVQGETSAA----------------------------------------------------------LLADATAVTMVRGDAARCYDHLPQEAVVNIMRGLV

                                                                                                                                                 

 

                                 1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures               ---|                                                                                                                    

Cryptosporidium parvum   SLPNEISLLSLYSRALSKTTIIPPFDNMNRDSYQDELGRSCIITSKGKLNMVPIFEKDHDEDQKVVKSKIKRIIGPDLDELLWNLKNSCLSNKDLSILGQKKAEIFTFLNSRRVINWKLV

Cryptosporidium hominis  SLPNEISLLSLYSRALSKTTIIPPFDNMNRDSYQDELGRSCIITSKGKLNMVPIFEKDHDEDHKVVKSKIKRIIGPDLDELLWNLKNSCLSNKDLSILGQKKAEIFTFLNSRRVINWKLV

Giardia lamblia          VT--GNAYVVLTYKEIAPSKMPKIRTVALPCQHNGCVSMDSISRYLLCKETPKKQPNSMLCPMHARIYKREDIIK-----MLELHLLNP-------------------------------

Giardia intestinalis     VT--GNAYVVLTYKEIAPSKMPKIRTVALPCQHNGCVSMDSISRYLLCKETPKKQPNSMLCPMHARIYKREDIIK-----MLELHLLNP-------------------------------

Leishmania amazonensis   KH--DAYRVLRFTVIHAVDSEATCKGGCLLRRTFTTRTIPCAEAECGFLARIPRGHIYWEEE-GRTPT-GPHTSAAVSRTTDASSRCGANLISGAAVRA---------------------

Leishmania infantum      KH--DAYRVLRFTAIHALDGEAACKGGCLLRRTFTTRTIACAEAECGVLARIPRGHIYWEEEEEGRTLSGPHTTAAVSRTTKASSRCGANLISGAAVRA---------------------

Trypanosoma brucei       TH--ETYYSLKLTVVTLTTVKNVSKKT-----------RSSHAESQLSSMKETNGSTVKHRKLQLSKRVKLVPGRYVQEG-VLYGIARGCIAYEEQSVGSDSLVSGEEIRS---------

2Ál                                                                                                                                                

 

                                 1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                      |---------------------------Motif B'---------------------|                                       

Cryptosporidium parvum   KEIIKIHLNTSFFRLRTCSKSLRLIKSKQLGNSIKFGKRFLSLFKQDFGIPQGSSISYILCCLYYNFLDLNPEIQNLLGHSFFSSSYISLSFLNPIKQEKVQLLDPTEKDLFSQHDLETG

Cryptosporidium hominis  KEIIKIHLNTSFFRLRTCSKSLRLIKSKQLGNSIKFGKRFLSLFKQDFGIPQGSSISYILCCLYYNFLDLNPEIQNLLGQSFFSSSCISLSFLNPIKQEKAQVLDPTKKDLFSQHDLETG

Giardia lamblia          --------------------------------LVIHEGGV---YRLTSGIPQGSVVSTVLFNCYSSLLHVQLLNTGIVSSRL--------------------------------------

Giardia intestinalis     --------------------------------LVIHEGGV---YRLTSGIPQGSVVSTVLFNCYSSLLHVQLLNTGIVSSRL--------------------------------------

Leishmania amazonensis   -----------------------LLSEHIRHHLVVVSGG--SLFEQRVGILQGSPVAMLLCDRLFSNVVDTALSSILSEHAER-------------------------------------

Leishmania infantum      -----------------------LLSEHLRHHLVVVSGG--NLLEQRVGILQGSPVAMLLCDRLFSDVVDTALSGILSEHAER-------------------------------------

Trypanosoma brucei       -----------------------VLQKHLQSHLVMLNG-K--MYIQRMGINQGSAVAMLLCDQLLERV-DAALSSILSEHEEP-------------------------------------

                                                                                                                                                 

 

                                 1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1560

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                          |-----------Motif C-------------|            

Cryptosporidium parvum   LSRYPEFKENEINIYNTSTSKKRRLEISEYNINAKSVLLQPSEEFNNNINNQNCQIRANLKSYDQESPSQSNKQESLLLRWVDDFLFLTSDLESAKKFLKLL-----YIQK-LWGSNVSK

Cryptosporidium hominis  LSRYPEFKENEINIYNTSTSKKRRLEISEYNINAKSVLLQPSEEFDNNINNQNCQIRVNLKNYDQESPSQSNKQESLLLRWVDDFLFLTSDLESAKKFLKLL-----YIQK-LWGSNVSK

Giardia lamblia          ---------------------------------------------------------------------------FFYRTFVDDWLLLTTSIALLDAYIEYLNIMRDHGAYFRLSCFTKP

Giardia intestinalis     ---------------------------------------------------------------------------FFYRTFVDDWLLLTTSIALLDAYIEYLNIMRDHGAYFRLSCFTKP

Leishmania amazonensis   ---------------------------------------------------------------------------SLLLRRVDDVLVATTSPAAAERCLRAM-----QRGWPSVGYLSNP

Leishmania infantum      ---------------------------------------------------------------------------SLLLRRVDDVLVATTSPAAAERCLQAM-----QRGWPSVGYLSNP

Trypanosoma brucei       ---------------------------------------------------------------------------ALLLRRVDDVLVVTLSRAAASRCEDAL-----RSGWSEIGFFCQE

                                                                                                                       |-------------------Motif 

 

                                 1570      1580      1590      1600      1610      1620      1630      1640      1650      1660      1670      1680

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                   |--------------------Motif E------------------------|                                               

Cryptosporidium parvum   DKINSNFPWIDHNNEIIILEEDDVLLSSP---------SSSCSSSCSSSSSSSSSSSSSS-SSSSSFPPSTE-CTSSPVEKRINTNKSEKDCQNEKEMINKAKIASKQFHKQVSWTGMKF

Cryptosporidium hominis  DKINSNFPWIDHNNEIIIFEEDDVLLSSP---------SSSCSSSCSSSSSSSS-------SSSSSFPPSTE-CLSSPVEERTNTSKGEKDCQNEKEMINKAKIALKQFHKQVSWTGMKF

Giardia lamblia          HKNSPFAPIATLDCSREPIPKKSLYTPNLNQDMYKLDVPRYCGYIFLEN-VAIIDVLKWFSSTRTNGSPSYPMIFGSGISVMQRLRLVFKKR----------------------------

Giardia intestinalis     HKNSPFAPIATLDCSREPIPKKSLYTPNLNQDMYKLDVPRYCGYIFLEN-VAIIDVLKWFSSTRTNGSPSYPMIFGSGISVMQRPRLVFKKR----------------------------

Leishmania amazonensis   SKLTLS------KACG---SLVP-----------------WCGLLLHDTTLEVSVEWRRIGVLLGSLRVGDPHYVHRGDYEPLYLTQRFLAVLQLRVA-PTALCGRMNSKTRQLQTFYEV

Leishmania infantum      SKLTLS------TACG---SLVP-----------------WCGLLLHDTTLEVSVEWRRIGVLLASLRVGDPHYVHRGDHEPLYLTQRFLAVLQLRVA-PTVLCGRMNSKTRQLQTFYEV

Trypanosoma brucei       EKLR-RV-----T-CG---QPVR-----------------WCGLLWDPVTLEFAVDWARLAKMMPYLAVRP--RTGCEPLLSSLRFIRILRLRTP----MTALCRQINSKSRVVQTLYEI

                         D------------------|                                                                                                    

 

                                 1690      1700      1710      1720      1730      1740      1750      1760      1770      1780      1790      1800

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                                                                       

Cryptosporidium parvum   SSEYSYLNCMVSPWKNLEFICVMDTVTLTTKHQFTSNYSNFHRFKSTTISENLQKSNYMWSVLGIKLIRYFDFRIKNGLLYDCKINSLFTVSFKYNSTNNQPIN-                

Cryptosporidium hominis  SSEYNYLNCMVSPWKNLEFICVMDTVTLTTKHQFTSNYSNFHRFKSMTISENLQKSNYMWSVLGIKLIRYFDFRIKNGLLYDCKINSLFTVSFKYNSTNKQPIN----------------

Giardia lamblia          -----------------------------------------IRDLRCFIERSIQAPDPRIKVDGSILYAYIRAVTFCILCYTRNIRYSESLRTLLRSTFCSLKATVWRHSTSRAIFIHVS

Giardia intestinalis     ---------IRDLRCFIERSIQAPDPRIKVDGSILYAYIRAVTFCILCYTRNIRYSESLRTLLR-----------------------STFCSLKATVWRHSTSRAIFIHVSKR-IILHVY

Leishmania amazonensis   GLLWTRVVLEKVQEALPVARNCCVTVLLLRPLAVCVGR----------------------------------------LCRLLSRHQRFLAARQSACDVSAAEVRACVLTALHRTVQAKL

Leishmania infantum      GLLWSRVVLEKVQEALPAARNRCVAVLLLHPLAVCVGR----------------------------------------LCRLLNRHQRFLAARKSACDVSAAEVRACVLTALHRTVQAKL

Trypanosoma brucei       GLLWSRFFLDKLKANAAFFR--PHVRTILQPLALATAT----------------------------------------LRRLVRKHSFDLQRLGSFCDVTDVEVRLCISAALYHTLHQRL

                                                                                                                                                 

 

                                 1810      1820      1830      1840      1850      1860      1870      1880      1890      1900      1910      1920

                         ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

structures                                                                                                                                       

Cryptosporidium parvum                                                                                                                            

Cryptosporidium hominis  -----------                                                                                                              

Giardia lamblia          KRIILHVYGHNPRIRGLLLGMLSR--------------------------------------                                                           

Giardia intestinalis     GHNPRIRGLLLGMLSR----------------------------------------------                                                           

Leishmania amazonensis   RVLQARTVRAMTAQSGRTQRGPSLKGRRNNFCSTKASSVGRKGCEQRRRGRNRRN-TRVCLRSFWWLTAAEVESQWRRSLGALYRAAPRPGEACGSTASSPSPAASASLLMEDGPLSMHA

Leishmania infantum      RVLQARTVRVMTAQRGRTPRGTSLKGRQKPPCTNKASSAGCKYCERRRKGRNRRCSTRVCLRSFWWLAAAEVELQWRRSLGALHRAAPHPGEARGSTAPSLSPSASASLLMEDGPLSMHA

Trypanosoma brucei       AFMIGR---------------MSSVGKKKFLILMTAVLKRKMGELGSRINRNNQMESSLPSAADLLLVEGGDGVVSRGLAAVRFRPVETVRFQGCATRSA--------------------

                                                                                                                                                 

 

                                 1930      1940

                         ....|....|....|....|

structures                                    

Cryptosporidium parvum                        

Cryptosporidium hominis                       

Giardia lamblia                               

Giardia intestinalis                          

Leishmania amazonensis   RALSATRLSQT          

Leishmania infantum      RALSATRLSQT          

Trypanosoma brucei       -----------