10        20        30        40        50        60        70        80        90       100       110       120

                      ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

motif                                                                                              |------------------------------------------

Homo sapiens          -----------------MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWR---LVQRGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFG

Mesocricetus auratus  -----------------MPRAPRCRAVRALLRSQYRQVWPLATFVRRLGPEGRQ---LVQPGDPKVFRTLVARCLVCVPWDSQPPPADLSFHQVSSLKELVARVVQRLCERGERNVLTFG

Mus musculus          -----------------MTRAPRCPAVRSLLRSRYREVWPLATFVRRLGPEGRR---LVQPGDPKIYRTLVAQCLVCMHWGSQPPPADLSFHQVSSLKELVARVVQRLCERNERNVLAFG

Rattus norvegicus     -----------------MPRAPRCPAVRSLLRSRYREVWPLATFVRRLGLEGSR---LVQPGDPKVFRTLVAQCLVCVPWGSQPPPADLSFHQVSSLKELVSRVVQKLCERGERNVLAFG

Canis familiaris      -----------------MPRAPRCRAVRALLRGRYREVLPLATFLRRLGPPGRL---LVRRGDPAAFRALVAQCLVCVPWGARPPPAAPCFRQVSCLKELVARVVQRLCERGARNVLAFG

Bos taurus            -----------------MPRAPRCRAVRALLRASYRQVLPLAAFVRRLRPQGHR---LVRRGDPAAFRALVAQCLVCVPWDAQPPPAAPSFRQVSCLKELVARVVQRLCERGARNVLAFG

Coturnix japonica     MERGADPGVGVRRRLHNMARAEPFAAVLGALRGCYAEATPLEAFVRRLQDGGTGEVEVLRGDDAQCYRTFVSQCVVCVPRGARPIPRPICFQQLSSQNEVITRIIQRLCEKKKKNILAYG

Gallus gallus         MERGAQPGVGVRR-LRNVAREEPFAAVLGALRGCYAEXTPLEAFVRRLQEGGTGEVEVLRGDDAQCYRTFVSQCVVCVPRGARAIPRPICFQQLSSQSEVITRIVQRLCEKKKKNILAYG

Xenopus laevis        -----------------MPLRTGGATLLSILQRLYGQVLGIVEYTDTLQVPGGIKVPVLLEGDSEKFRSFVAELVVCIPRGTKPLPSPVSFLQLSTQREVVARVIQRICEKKRKNVLAFG

Oryzias latipes       ------------------MTSGDLSSVLNILRSLYKRTRTLEEFADGVVFREGRRAALLQPSDTHSFKSFVRGVFVCSDEELQDVPSC---NQTCTFPELLAFILNSLKRKRRRNVLAHG

Oryzias melastigma    ------------------MTSEDVSRVLELLRSLYKRTQTLQEFADGVVFRDGRRATLLQPSDSIVFQTFVRAVFVCSDEELREVRSS---KQICTFSEILAFVLNNLKRSKSNNVLAQG

Epinephelus coioides  ------------------MSTADLSPTLDILRSVYQHVQTLEQFTDSIVFREGHRAQLTEHTDTNRFKSFVRGVFVCFDRELQQVPSC---NRICTLPELLAFVLNSLKRKRKRNILAHG

Takifugu rubripes     ------------------MSITDLSPTLGILRSLYPHVQVLVDFADDIVFREGHKATLIEESDTSHFKSFVRGIFVCFHKELQQVPSC---NQICTLPELLAFVLNSVKRKRKRNVLAHG

Danio rerio           -------------MSGQYSTDGGFRPVLEILRSLYPVVQTLEEFTDGLQFPDGRKPVLLEETDGARFKKLLSGLIVCAYT-PPQLRVP---AQLSTLPEVLAFTLNHIKRKKLRNVLGFG

region                |-----------------------------------------region v-Ia----------------------------------|                                 

                                                                    |-----------------------------------------------------------------------RI

                                                                                                               |-------------------------DAT d

 

                              130       140       150       160       170       180       190       200       210       220       230       240

                      ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

motif                 -motif GQ------------------------------------------------------------------------------------|                           

Homo sapiens          FALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPR--------------RRLGCERAWNHS

Mesocricetus auratus  FALLNGAQGGPPMTFTTSVRSYLPNSVTESLRVSGAWMLLLNRVGDDLLVYLLARCALYLLVPPSCAYQVCGSPLYQICATAETWPSVSRIYRPTRPVG-----RNFTHLGSTHRVRNSS

Mus musculus          FELLNEARGGPPMAFTSSVRSYLPNTVIETLRVSGAWMLLLSRVGDDLLVYLLAHCALYLLVPPSCAYQVCGSPLYQICATTDIWPSVSASYRPTRPVG-----RNFTNLRFLQQIKSSS

Rattus norvegicus     FALLNGARGGPPMAFTTSVHSYLPNSVTESLCVSGAWMLLLSRVGDDLLVYLLSHCALYLLVPPSCAYQVCGSPLYQICATTDTWSSVPAGYRPTRPVG-----GNFTNLGSAHQIKNSG

Canis familiaris      FALLDGARGGPPVAFTTSVRSYLPNTVTETLRGSGAWGLLLRRVGDDVLTHLLARCALYLLVAPSCAYQVCGPPLYDLCAPASLPLPAPGLPGLPGLPG--------------LGAGAGA

Bos taurus            FTLLAGARGGPPVAFTTSVRSYLPNTVTDTLRGSGAWGLLLHRVGDDVLTHLLSRCALYLLVPPTCAYQVCGPPLYDLRAAAAAARRPTRQVGGTRAGF----------GLPRPASSNGG

Coturnix japonica     YSLLDENSCHFRVLPSSCIYSYLSNTVTETIRISGLWEILLSRIGDDVMMYLLEHCALFMLVPPSNCYQVCGQPVYELISRNIGPSPGFVRRRYSRFKHNSLLDYVRKRLVFHRHYLSKS

Gallus gallus         YSLLDENSCHFRVLPSSCIYSYLSNTVTETIRISGLWEILLSRIGDDVMMYLLEHCALFMLVPPSNCYQVCGQPIYELISRNVGPSPGFVRRRYSRFKHNSLLDYVRKRLVFHRHYLSKS

Xenopus laevis        YGLVDE-KNSLNIRLTPNICNYFPNPTTTTISTSILWETLLTRVGDDVMMYWLEQCSIFVFVPPRCCYQITGQPIYTLPSDDVFLFQSQSFTQSNVLLRYIKRNVFHLRKKYLKPKHSMT

Oryzias latipes       YNFLGVAQEDRDADHFRFQGD-LSQSAAY-IHSSDLWKKVTARLGTDVTRYLLGSCSVFVLAPPSCIFQICGVPAYDRVSMTTASSGFLLRPPSRKHKSFQVGKKRRSANLTKRGSVGDV

Oryzias melastigma    YNWKT-AQENKDVNLFRFQGD-LSQSANY-IHSSEQWKKVMAHLGPDFLLHLLGSFSVFVVAPPSCVFQICGAPAYDRVSVTTASSRFLLKHPSRRHTSSRLGKNRCSVKFKMRDSAEDE

Epinephelus coioides  YSFLSLAQEERDADHFKSQGD-ITQSAAY-IHGSDLWKKVTIRLGTDITRYLLESCSVFVAVPPSCVFQVCGAPVYDRVSMTTAPAGFCLQSRARTLNGGQAGRNRGAVTVRRKHKVEND

Takifugu rubripes     YNFQSLAQEERDADQFKLQGD-VTQSAAY-VHGSDLWRKVSMRLGTDITRYLFESCSVFVAVPPSCLFQVCGIPIYDCFSLATASLGFSLQSRG--CRERCLGVNSMKRRAFNVKRYLRK

Danio rerio           YQCSDVTTS---SDPFRFHGD-VSQTAAS-ISTSEVWKRINQRLGTEVTRYLLQDCAVFTTVPPSCVLQVCGEPVYDLLMPRSWSGFFLSNSDNERISGAMRKFPAVQKTVAISKKRTRD

region                                                 |-------------region v-Ib----------------|                                              

                      D1--------------------------------------------------------|                                                              

                      omain-------------------|        |--------------motif T2------------------|                                              

 

                              250       260       270       280       290       300       310       320       330       340       350       360

                      ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

motif                                                                                                                                          

Homo sapiens          VREAGVPLGLPAPGARRRGGSASRSLPLPKRPR---------------------------------------------------------------------------------------

Mesocricetus auratus  HQEAWKPPPLPSREAKRSLSITNRSVPPSKKAR---------------------------------------------------------------------------------------

Mus musculus          RQEAPKPLALPSRGTKRHLSLTSTSVPSAKKAR---------------------------------------------------------------------------------------

Rattus norvegicus     HQEAPKPQALPSRGTKRLLSLTSTNVPSAKKAR---------------------------------------------------------------------------------------

Canis familiaris      SADLRPTRQAQNSGARRRRGSPGSGVPLAKRPR---------------------------------------------------------------------------------------

Bos taurus            HGEAEGLLEARAQGARRRRSSARGRLPPAKRPR---------------------------------------------------------------------------------------

Coturnix japonica     QWWKCKPRHQGHVSSRRKRSQ-RIQSLRPGYQSSEKVDFQAGRHISIVNAHMEKQSCSSLCLPNRAPSLKRKRDGEQVEIAAKRVKVMEKEIEKQACSIIPDVNQSSSQRH-RTWHVAPR

Gallus gallus         QWWKCRPRRRGRVSSRRKRRSHRIQSLRSGYQPSAKVNFQAGRQISTVTARLEKQSCSSLCLPARAPSLKRKRDGEQVEITAKRVKIMEKEIEEQACSIVPDVNQSSSQRHGTSWHVAPR

Xenopus laevis        SRMLTWRRNKSPSGLLIRSKTSMAVTTEIHSKRKLCSKDICVIPDKKRRDNLDKDDTVDHFDLPMCRSVSYL------------------------------------------------

Oryzias latipes       EESRKRRRVESGVSARKRKREPEEEESRERRRG---------------------------------------------------------------------------------------

Oryzias melastigma    EKRRKKRRVESTNSSRKRKREPEEEESSKRRCD---------------------------------------------------------------------------------------

Epinephelus coioides  KRNRRVKKRQRQ--ADEKDEEEVMTCPGKRRRVG--------------------------------------------------------------------------------------

Takifugu rubripes     RKTETDQKDE------------ARVCSGKRRRV---------------------------------------------------------------------------------------

Danio rerio           NEKYISVKRRRVKETVNNNNGNYRSLCFAISKKRAIDNEENISLKRRR------------------------------------------------------------------------

region                                                                                                                                         

                                                                                                                                               

                                                                                                                                               

 

                              370       380       390       400       410       420       430       440       450       460       470       480

                      ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

motif                                                                                                                                          

Homo sapiens          ----------------------------RGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHF

Mesocricetus auratus  ------------------------------CDLAPRLEKGPYRQAVPTPSDKTWVPNPAKSHAVPISRTTKEDLSSGVKAPGLSRSGSVCYKHKPSSTSLQSPLCQNAFQLRPYTETKRF

Mus musculus          ---------------------------------CYPVPRVEEGPHRQVLPTPSGKSWVPSPARSPEVPTAEKDLSSKGKVSDLSLSGSVCCKHKPSSTSLLSPPRQNAFQLRPFIETRHF

Rattus norvegicus     ---------------------------------FEPALRVDKGPHRQVVPTPSGKTWAPSPAASPKVPPAAKNLSLKGKASDPSLSGSVCCKHKPSSSSLLSSPPQDAEKLRPFTETRHF

Canis familiaris      --------------------------------------------RSVASEPERGAHRSFPRAQQPPVSEAPAVTPAVAASPAASWEGGPPGTRPTTPAWHPYPGPQGVPHDPAHPETKRF

Bos taurus            --------------------------------------------RGLEPGRDLEGQVARSPPRVVTPTRDAAEAKSRKGDVPGPCRLFPGGERGVGSASWRLSPSEGEPGAGACAETKRF

Coturnix japonica     AVGLIKERYISERSNSEMSGPSVVHRSHPGKRPVADKSSFPQGVQGNKRVKTGAEKRVESNRRGTEMCINPTHKPNRRGVERRINPSHKPGLNSVQTEPMEGASSGDRKQENPPAHLAKQ

Gallus gallus         AVGLIKEHYISERSNSEMSGPSVVHRSHPGKRPVADKSSFPQGVQGNKRIKTGAEKRAESNRRGIEMYINPIHKPNRRGIERRINPTHKPELNSVQTEPMEGASSGDRKQENPPAHLAKQ

Xenopus laevis        ------------------------------------SNMYPKTNVQVTGLITSGYKKTKTFQCQKPVSCEQKKTTAFYSVAGDCNLSLKDNVNKLITNASVPTAQSRLSFSNIFIDFGRT

Oryzias latipes       ---------------------------------------------------VHHEERRQHEAVLDESTLSGKSGENDAAAVKPPPETSAAPPPLEGGPSWRSGAFPPLPSSQCFIRTLGF

Oryzias melastigma    ----------------------------------------------------THHEESSQHACSEAVLVESTVSENDKSSLKMPPETSAASLPLEGEPSWRSGTFPPLPSSQCFIRTMGL

Epinephelus coioides  ------------------------------------------QHEHTQEVQVCSESVGEGQPTSVEPSLTLKTLENGATVSKQPAETQTTTLPLEGGPSWRSGMFPPLPPSQCFIRTLGF

Takifugu rubripes     -----------------------------------------------------MEEDKVSCETMQDGESGKTTLVQKQPGSKKRSEMEATLLPLEGGPSWRSGTFPPLPPSQSFMRTLGF

Danio rerio           ----------------------------------------MEETDQVAKIRNENHESQSFAISKKRARDNEENISLKRQRMEEIDQVAKIRNENHGSQSWKPADQRPPRPSQCSIRVLSM

region                                                                                                                                         

                                                                                                                                               

                                                                                                                                               

 

                              490       500       510       520       530       540       550       560       570       580       590       600

                      ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

motif                                                         |-motif VSR-|                                    |--------motif CP-----------|   

Homo sapiens          LYS--SGDKEQLRPSFLLSS---------------LRPSLTGARRLVETIFLGSRPWMPGTPRRLP-------RLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCA

Mesocricetus auratus  LYS-REGGRERLNPSFLLNN---------------LQPSLTGARRLVEILFLGMRPRTSGPLCGRR-------RLSKRYWQMRPLFQQLLVNHARCPYVRLLRSHCRFRTAAHQVAGA--

Mus musculus          LYS-RGDGQERLNPSFLLSN---------------LQPNLTGARRLVEIIFLGSRPRTSGPLCRTH-------RLSRRYWQMRPLFQQLLVNHAECQYVRLLRSHCRFRTANQQVTDA--

Rattus norvegicus     LYS-RGGGQEELNPSFLLNS---------------LPPSLTGARRLVEIIFLGSRPRTSGPFCRTR-------RLPRRYWQMRPLFQQLLMNHAKCQYVRFLRSHCRFRTANQRVPDA--

Canis familiaris      LYC--SGGRERLRPSFLLSA---------------LPPTLSGARKLVETIFLGSAPQKPGAARRMR-------RLPARYWRMRPLFQELLGNHARCPYRALLRTHCPLRAMAAKEGSGNQ

Bos taurus            LYC--SGGGEQLRRSFLLCS---------------LPPSLAGARTLVETIFLDSKPGPPGAPRRPR-------RLPARYWQMRPLFRKLLGNHARSPYGALLRAHCPLPASAPRAGPDHQ

Coturnix japonica     LPNRFLRSAVYFEKKFLLYSRNYQEYFPKSFILSRLQDCQAGGRRLIETIFLSQNPVKEKQNQSLPQQKWRK-KLPKRYWQMRELFQKLVKNHKTCPYLVFLRKNCPVLLSEACLEKTEL

Gallus gallus         LPNTLSRSTVYFEKKFLLYSRSYQEYFPKSFILSRLQGCQAGGRRLIETIFLSQNPLKEQQNQSLPQQKWRKKRLPKRYWQMREIFQKLVKNHEKCPYLVFLRKNCPVLLSEACLKKTEL

Xenopus laevis        LYL-SISYKKGFSESFILNS---------------LDSTPSGSQKLVETIFLSNFLAEQNFDQPKRDENCRY-KLPKRYWKMKPHFQELIQNHKKFPYLVYLNKHCPVRSSMACSEKR--

Oryzias latipes       LYGGRGMHGFCLNRKRRTAA---------------GPRRLQGQDLVRLVFFEGLPYLNGQERKPK--------KLPLRYFNMVPVFGRLLQRHRKCRYSSVLHRMCPVVELSRAAQG---

Oryzias melastigma    LYGGQGMQGFCLNRKKQTAA---------------GLRRLQGQDLVRLVFFQGLPYLDKQTRDPK--------KLRLRFFRMVPVFGELLQRHRKCPYTRVLQRMCPLVEESRAAPG---

Epinephelus coioides  LYGGRGMRGFLLNRKKKTPD---------------GCRRLQGTDLVRIVFFEGLAYLNGLERKPK--------KLPRRFFTMVPVFSRLLRQHRRCPYSRILQRMCPVVEDRNTQQE---

Takifugu rubripes     LYGGRGMRSFLLNRKKKTAE---------------GFRKIQGRDLIRIVFFEGVLYLNGLERKPK--------KLPRRFFNMVPLFSQLLRQHRRCPYSRLLQKTCPLVGIKDAGQA---

Danio rerio           LYNGRGMKNFLLNRKLKGVG---------------GARRMQGEDLVRMIFLQ----SESNDSKPK--------KLPKRFFAMVPLFSRLLRQHRKCPYRLFLQRKC----AGNPDVK---

region                                                                           |--------------------region v-II------------------|           

                                                         |------------------------------------------------------------------------------------

                                                                                                                                               

 

                              610       620       630       640       650       660       670       680       690       700       710       720

                      ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

motif                                                                        |--------------------------------motif QFP-----------------------

Homo sapiens          REK-------------------------------------PQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLG-KHAKLSLQELT

Mesocricetus auratus  -------------------------------------------------LNTTSPQRLMNLLRLHSSPWQVYGFLQACVGKLVPPGLWGSRHNQRRFFKNVKRFISLG-KYDKLSLQELT

Mus musculus          --------------------------------------------------LNTSPPHLMDLLRLHSSPWQVYGFLRACLCKVVSASLWGTRHNERRFFKNLKKFISLG-KYGKLSLQELM

Rattus norvegicus     --------------------------------------------------MDTSPSHLTSLLRLHSSPWQVYGFLRACLRELVPAGLWGTRHNERRFLKNVKKFISLG-KYAKLSLQELM

Canis familiaris      AHR--------------------------------GVGICPLERPVAAPQEQTDSTRLVQLLRQHSSPWQVYAFLRACLCWLVPTGLWGSRHNQRRFLRNVKKFISLG-KHAKLSLQELT

Bos taurus            KCP--------------------------------GVGGCPSERPAAAPEGEANSGRLVQLLRQHSSPWQVYGLLRACLRRLVPAGLWGSRHNERRFLRNVKKLLSLG-KHGRLSQQELT

Coturnix japonica     TLQVALPGEAKVPKHTEHGKESTEGAALNSFHAPPSMPVCGQSERGEQHPAEGSDPLLGELLRQHSSHWQVYGFVRECLERVIPAELWGSSHNKCRFLKNVKAFISMG-KYDKLSLQQLM

Gallus gallus         TLQAALPGEAKVHKHTEHGKESTEGTAPNSFLAPPSVLACGQPERGEQHPAEGSDPLLRELLRQHSSHWQVYGFVRECLERVIPAELWGSSHNKCRFFKNVKAFISMG-KYAKLSLQQLM

Xenopus laevis        -----------------------------------SLQKNRIENDGKQLKHFTTKANLLSLLKQHSSIWQVYMFVRECLNNVVPDIMWGSSHNKCRFFRNVKSFLFFSGKFGKISLSELM

Oryzias latipes       --------------------------------------------------------ELSSLIPQHCAPHRVYLFVRECLTAVVPEELWGSDHNRLQFFSRVRGFLKSG-KFERISVAELM

Oryzias melastigma    --------------------------------------------------------QPSSLIPLHCDPHRVYLFVRACLITVVPEELWGSDHNRLQFFTKVRCFLKNG-KFERVSVAELM

Epinephelus coioides  --------------------------------------------------------DLSSLLPRHCAPHRVYLFVRECLTAVIPPELWGSDHNRLHFFSRVRGFLRSG-KFERLSLAELM

Takifugu rubripes     --------------------------------------------------------ELSSFLPQHCGSHRVYLFVRECLLAVIPQELWGSEHNRLLYFARVRFFLRSG-KFERLSVAELM

Danio rerio           --------------------------------------------------------DMESLLKSHSSPYRVYLFVRECLRHIIPHELWGCQENQLHFLSNVKNFLLLG-KFERLTLVQLM

region                                                                                         |---------------------------------------region  

                      ---------------RID1-----------------------------------------------------------------------------------------------------

                                                                                                                                               

 

                              730       740       750       760       770       780       790       800       810       820       830       840

                      ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

motif                 ----------|                      |--------------------motif T------------------------|                         |-motif 1

Homo sapiens          WKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMS-VYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPD

Mesocricetus auratus  WKMKVQDCRWLRSSPGNNCVPAAEHRTRERILAVFLFWLMD-AYVVELLRSFFYVTETTFQKNRLFFYRKSMWRRLQSIGVRHHLERVRLQELSQEEVRQRQEAWPAMPICRLRFIPKPS

Mus musculus          WKMKVEDCHWLRSSPGKDRVPAAEHRLRERILATFLFWLMD-TYVVQLLRSFFYITESTFQKNRLFFYRKSVWSKLQSIGVRQHLERVRLRELSQEEVRHHQDTWLAMPICRLRFIPKPN

Rattus norvegicus     WRVKVEDCHWLRSSPEKDTVPAAEHRLRERILAMFLFWLMD-TYVVQLLRSFFYITETTFQKNRLFFYRKSVWSKLQSIGIRQQLERVQLRELSQEEVKHHQDTWLAMPICRLRFIPKLN

Canis familiaris      WKMKVRDCTWLHGNPGACCVPAAEHRRREEILARFLVLVDGHIYVVKLLRSFFYVTETTFQKNRLFFYRKSVWSQLQSIGIRQLFNSVHLRELSEAEVRRHREARPALLTSRLRFLPKPS

Bos taurus            WKMKVQDCAWLRASPGARCVPAAEHRQREAVLGRFLHWLMG-AYVVELLRSFFYVTETTFQKNRLFFFRKRIWSQLQRLGVRQHLDRVRLRELSEAEVRQHQEARPALLTSRLRFVPKPG

Coturnix japonica     WKMRVNDCVWLRLAKGNHSVPAYEHCYREEILAKFLYWLMD-SYVIELLKSFFYITETMFQKNTLFYYRKFIWGKLQNIGIRNHFAKVHLRALSSEEMDVIRQKKYFPIASRLRFIPKIN

Gallus gallus         WKMRVNDCVWLRLAKGNHSVPAYEHCYREEILAKFLYWLMD-SYVIELLKSFFYITETMFQKNMLFYYRKFIWGKLQNIGIRDHFAKVHLRALSSEEMEVIRQKKYFPIASRLRFIPKMN

Xenopus laevis        WSMRVEDCSWIRLQKSDHFVPASEHLLREKILAKFVFWLMD-TYVIQLLKSFFYVTETMFQKHRLLFYRKSVWKKLQNIGLRKHLEKVKLRSLSSDELENMQQWKNVPLVSRLRFIPKTN

Oryzias latipes       WKIKVMDCDWLKLRRTAGRFPPSELAYRTRILSQFLTWLLD-GFVVGLVRACFYATESVGQKNAIRFYRQEVWSKLQDLAFRRHIAKGEMEELSPAQVASLP---KGTVISQLRFIPKTD

Oryzias melastigma    WKMKVMDCDWLKLRRTG-RFPPSELTYRTQILSLFLTWLLD-GFVVGLVQACFYATDSVGQKSTIRFYRPEVWNKLRDLAFRNHVAKGQMEELTPDQVASLP---KDAIISQLRFIPKAD

Epinephelus coioides  WKMKVNDCDWLKISKTG-RFPPSELSYRTQILGQFLAWLLD-GYVVSLVRACFYVTESVGQKNAVRFYRQEVWAKLQDLAFRGHLSKGQMEELTPAQVASLP---KTTVISRLRFIPKTD

Takifugu rubripes     WKIKVNNCDWLKISKTG-RVPPSELSYRTQILGQFLAWLLD-GFVVGLVRACFYATESMGQKNAIRFYRQEVWAKLQDLAFRSHISKGQMVELTPDQVAALP---KSTIISRLRFIPKTD

Danio rerio           WRMKVQACHWLGPKKRQ---CASEHRYREWMLGQCMGWMLS-GFVVGLVRAQFYITESMGHKHTLRFYRGDVWSRLQDQAFRAHLCKGQWRPLSPSQALKVP---NSAVTSRIRFIPKTS

region                v-III-----------------------------------------|   |---------------------region v-IV----------------|                     

                      -------------------------------------|                                                                                   

                                                                                                                                               

 

                              850       860       870       880       890       900       910       920       930       940       950       960

                      ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

motif                 ||-2-|                                                                         |---------motif A------------|            

Homo sapiens          GLRPIVNMDYVV---GARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVR-AQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQ--NTYCVR

Mesocricetus auratus  GLRPIVNMSYM----GTRAFDKGKQAQHFTQCLKTLFSVLNYELTKHTNLLGASVLGLNDIYRTWRTFVLRVR-TLDPAPRMYFVKADVTGAYDAIPQDKLVEVIANMIRHPD-NSYCIH

Mus musculus          GLRPIVNMSYSM---GTRALGRRKQAQHFTQRLKTLFSMLNYERTKHPHLMGSSVLGMNDIYRTWRAFVLRVR-ALDQTPRMYFVKADVTGAYDAIPQGKLVEVVANMIRHSE-STYCIR

Rattus norvegicus     GLRPIVNMSYGM---DTRAFGKKKQTQCFTQSLKTLFSVLNYERTKHPNLMGASVLGTSDSYRIWRTFVLRVR-ALDQTPRMYFVKADVTGAYDAIPQDKLVEIVANIIRRSE-SMYCIR

Canis familiaris      GLRPIVNMDYIM---GARTFHRDKKVQHLTSQLKTLFSVLNYERARRPSLLGASMLGMDDIHRAWRTFVLRIR-AQNPAPQLYFVKVDVTGAYDALPQDRLVEVIANVIRPQE-STYCVR

Bos taurus            GLRPIVNVGCVE---GAPAPPRDKKVQHLSSRVKTLFAVLNYERARRPGLLGASVLGMDDIHRAWRAFVLPLR-ARGPAPPLYFVKVDVVGAYDALPQDKLAEVIANVLQPQE-NTYCVR

Coturnix japonica     GLRPIVRLSRVVEGQKLSKESREKKIQRYNTQLKNLFSVLNYERTVNTSIIGSSVFGRDDIYRKWKEFVTKVFESGGEMPHYYFVKGDVSRAFDTIPHKKLVEVISQVLKPESQTVYGIR

Gallus gallus         GLRPVVRLSRVVEGQKLSKESREKKIQRYNTQLKNLFSVLNYERTVNTSIIGSSVFGRDDIYRKWKEFVTKVFESGGEMPHFYFVKGDVSRAFDTIPHKKLVEVISQVLKPESQTVYGIR

Xenopus laevis        GLRPISKISSTL-SSQQSKENQEKKIHHFSSQIRNLFSVLNYEWNRNCSLIGSSVFGMDDIYKKWKKFVLDFEKPQVEKLQFYFVKTDVKGAYDTIPHSKLDEVISKVINPNANEVYCIR

Oryzias latipes       GMRPITRVIG-----------ADSNTRLHHKRIRDLMSMLQARVRSAPALLGSTVWGMTDIHKVLRSL