10        20        30        40        50        60        70        80        90       100       110       120

                                ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

                                           |-NL--|                                                                            |---TruB I---|            

Homo sapiens                    MADAEVII-LPKKHKKKKERK---SLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVE

Rattus norvegicus               MADAEAAMTFPKKHKKKKERK---PLPEADVAEIQHAEDFLIKPESKAAQLDTSQWPLLLKNFDRLNVRTTHYTPIPCGSNPLKREIGEYVRTGFINLDKPSNPSSHEVVAWIRRILRVE

Mus musculus                    MADAEVI-TFPKKHKKKKDRK---PLQEDDVAEIQHAEEFLIKPESKVAQLDTSQWPLLLKNFDKLNVRTAHYTPLPCGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVE

Bos taurus                      MADAEVLI-LPKKHKKKKERK---SLPEEAVAEIQHAEEFLIKPESRVAQLDTSQWPLLLKNFDKLNVRTTHYTPLPCGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVE

Gallus gallus                   MADGDG---SSVKKRRKKDKR---SLPDEDVADIQHTEEFLIKPESRVAQLDTSQWPLLLKNFDKLNVLTTHYTPLPSGANPLKREISDYVRSGFINLDKPSNPSSHEVVAWIRRILRVE

Danio rerio                     MADTES-----KKEKKRKSKK----ISDEEVGDIQESGDFLIKPESKVASLDTSQWPLLLKNFDKLNIRTAHYTPLPHGSNPLKRGIHDYVRSGFINLDKPANPSSHEVVAWIKRILRVE

Drosophila melanogaster         MADVEV-----RKEKKKKKIKEEP-LDGDDIGTLQKQGNFQIKPSSKIAELDTSQWPLLLKNFDKLNIRSNHYTPLAHGSSPLNRDIKEYMKTGFINLDKPSNPSSHEVVAWIKKILKVE

Anopheles gambiae               MEVDI-PTSPIKKEKKKKKIKQEPDTEIENLGEIQKSGDFQLKPSSAIASLDTSKWPLLLKNFDRLNVRTNHYTPLPFGSSPLNRKINDYVSAGFINLDKPSNPSSHEVVAWIKRILKVN

Aedes aegypti                   MSDYEMGSPTIKKEKKKKKIKQEPGAEIENLGEIQKSGNFQIQPSAAIAKLDTSQWPLLLKNFDRLNVRTNHYTPLPFGSSPLNRKIKDYVTSGFINLDKPSNPSSHEVVAWIKKILKVD

Culex pipiens quinquefasciatus  MG-----SPHIKKEKKKKKIKQEPGVEVENLGEIQKSGDFQIKPSEAIAKLETSKWPLLLKNFDRLNVRTNHYTPLPFGSSPLNRKIKDYVTSGFINLDKPSNPSSHEVVAWIKKILKVE

Caenorhabditis elegans          MG---------KKDKRSK-------LEGDDLAEAQQKGSFQLPSSNETAKLDASQWPLLLKNYDKLNVRTNHYTPHVEGVSPLKRDIKNYISSGFFNLDKPSNPSSHEVVSWIKRILRCE

Schizosaccharomyces pombe       MTD-----------------------------THPGVDFMIKPEATSASKIDTAEWPLLLKNFDKLLVRTGHYTPIPCGNNPLKRPIAEYVSSGVINLDKPANPSSHEVVAWVKKILRVE

Saccharomyces cerevisiae        MSK----------------------------------EDFVIKPEAAGASTDTSEWPLLLKNFDKLLVRSGHYTPIPAGSSPLKRDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCE

Kluyveromyces lactis            MS-----------------------------------DEFVIKPESVSPSSNTSEWPLLLKDYDKLLVRSGHYTPIPAGASPLKRDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCE

Ashbya gossypii                 MS-----------------------------------EEHMIKPENVAPSADTSEWPLLLKNYDKLLVRSGHYTPIPAGASPLKRDLKSYVSSGVINLDKPSNPSSHEVVAWIKRILRCE

Lodderomyces elongisporus       MSK----------------------------------EDFQIKPEAVTPANNTSDWPLLLKNYDKLLVRSGHYTPIPAGSSPNNRDLKSYVSSGVINLDKPSNPSSHEVVAWIKRILRVE

Pichia stipitis                 MS-----------------------------------DEYFIKPEAVSPSNDTSEWPLLLKNFDKLLVRSGHYTPIPSGSSPLKRDIKSYISSGVINLDKPSNPSSHEVVAWIKRILRSE

Pichia guilliermondii           MAPHDAMRIF------------LNTIIVVFIFPVAMSDEYMIKPESIAPSNDTSEWPLLLKNFDKLLVRSGHYTPIPAGSSPLKRDLKSYVSSGVINLDKPSNPSSHEVVAWIKRILRTE

Zygosaccharomyces rouxii        MSK-----------------------------------DFVIKPDTSGPTPDTAEWPLLLKDYDKLLMRSGHYTPIPAGSSPGKRDIKSYVNSGVINLDKPSNPSSHEVVAWIKRILRCE

Aspergillus fumigatus           MAV----------------------------SVTKEEMDYTIKPEAGASNISTEDWPLLLKNYDKLMVRTGHFTPIPAGCSPLKRDLKSYISSGVINLDKPSNPSSHEVVAWMKRILRAE

Aspergillus clavatus            MAV----------------------------ALAKEEMDYTIKPEAGASNISTEEWPLLLKNYDKLLVRTGHFTPIPAGCSPLKRDLKSYVSSGVINLDKPSNPSSHEVVAWMKRILRAE

Aspergillus nidulans            M---------------------------------AKEVDYTIKPEATASNINTEDWPLLLKNYDKLMVRTGHFTPIPAGSSPLKRDLKSYINSGVINLDKPSNPSSHEVVAWMKRILRAE

Chaetomium globosum             M----------------------SDSKALVKKGEDNEVEYMIKPQTLVPTLNTSDWPLLLKNYDKMLVRSGHFTPIPNGSSPYKRDIKSYVSSGVINLDKPSNPSSHEVVAWLKRMLRVE

Magnaporthe grisea              MGG-------------------NKDALALARRDEEVDEEFSIKPEQVTPALDTSSWPLLLKNYDKLHIRTGHFTPIPNGSTPLRRDIKSYISSGVINLDKPSNPSSHEVVAWIKRILRCE

Neurospora crassa               MG---------------------------------AETEHVIKPQATEPAVDTSEWPLLLKNYSNLLVRTGHFTPIPAGSSPSKRDIKSYVSSGVINLDKPSNPSSHEVVAWIKRMLRVE

Botryotinia fuckeliana          MALV--------------------------STKKEQEVDYTIKPEALTPAVDTSSWPLLLKNYNNLLVRTGHFTPIPNGCTPLKRDLKSYISSGVINLDKPSNPSSHEVVAWVKRMLRVE

Pyrenophora tritici-repentis    MALV-----------------------------QTDPDAYVIKPAAAAPAIDTSDWPLLLKNYSDLLVRTSHYTPIPNGCAPLSRDLKSYISSGVINLDKPSNPSSHEVVSWIKRMLRVE

Neosartorya fischeri            MAV----------------------------SVAKEEMDYTIKPEAGASNISTEEWPLLLKNYDKLMVRTGHFTPIPAGCSPLKRDLKSYISSGVINLDKPSNPSSHEVVAWMKRILRAE

Coccidioides immitis            MAA------------------------------SKSDMDFSIKPEAATPPIPTSEWPLLLKNYDKLLVRTGHFTPIPAGCTPLKRDLKSYISSGVINLDKPSNPSSHEVVAWMKRILRVE

Dictyostelium discoideum        MTT--------------------DKKSKSKSSEKSTQEVEQVIKPEKTPILDTSKWPLLLKNYDQLSVRTGHYTPIPNGHSPLKRPIKEYVKYGIINLDKPSNPSSHEVVAWIRTILRVT

Arabidopsis thaliana            MAEVDI-------------SHSKKKKQDKTENDAADTGDYMIKPQSFTPAIDTSQWPILLKNYDRLNVRTGHYTPISAGHSPLKRPLQEYIRYGVINLDKPANPSSHEVVAWIKRILRVE

Chlamydomonas reinhardtii       MSV----------------------------GEAQQRTDFLIQPEKTVPKLDTSKWPLLLKNYDKLNVRTGHYTPIPAGSTPLKRPLKEYLSYGCINLDKPANPSSHEVVAWVKRMLRVE

Cryptosporidium parvum          SSM---------------------GKRKELEEMSDGKIETVIKPESKSQPIDTSNWPLLLKNYSKLNVRTGHYTPLPYGNSPLNRNLADYLSYGIINLDKPANPSSHEVVAWIKKILRCE

Euglena gracilis                MAKA----------------------------QWENDFSIPTESGEKGAALDSSEWPLLLKNYDKLNVRSAHYTPIPQGHTPLKRPIKAYLQYGCLNLDKPSNPSSHEVVSWLKRILKVE

Methanocaldococcus jannaschii   MILLE------------------------------------------------KTQEKKINDKEELIVKEEVETNWDYGCNPYERKIEDLIKYGVVVVDKPRGPTSHEVSTWVKKILNLD

 

                                        130       140       150       160       170       180       190       200       210       220       230       240

                                ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

                                    |---TruB II--|                                                                                                      

Homo sapiens                    KTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEG-GTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGL

Rattus norvegicus               KTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGVVRLHNAIEG-TAQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESRVVEYDPERRLGVFWVSCEAGTYIRTLCVHLGL

Mus musculus                    KTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEG-GTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGL

Bos taurus                      KTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEG-GTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGL

Gallus gallus                   KTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIES-EAQLARAIETLTGALFQRPPLIAAVKRQLRVRTIYESKLVEYDPERRLGIFWVSCEAGTYIRTLCVHLGL

Danio rerio                     KTGHSGTLDPKVTGCLIVYVERATRLVKSQQSAGKEYVGIVRLHNALEN-EHQLARALECLTGALFQRPPLIAAVKRQLRVRTIYESKLIEYDPERRLGIFWVSCEAGTYIRTLCVHLGL

Drosophila melanogaster         KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAIFKLHGAVES-VAKVRQGLEKLRGALFQRPPLISAVKRQLRVRTVYDSKLLDYDETRNMGVFWVSCEAGSYIRTMCVHLGL

Anopheles gambiae               KTGHSGTLDPKVTGCLIVCINRATRLVKSQQSAGKEYVAVFKLHSAVEK-IAKVTQGLEKLRGALFQRPPLISAVKRQLRVRTVYDSKLLDYNDQRNIGVFWVSCEAGSYIRTMCVHLGL

Aedes aegypti                   KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAVFKLHSAVES-VAKVNQGLEKLRGALFQRPPLISAVKRQLRVRTVYDSKLLDYDDQRNMGVFWVSCEAGSYIRTMCVHLGL

Culex pipiens quinquefasciatus  KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAVFKLHSAVES-VAKVNQGLEKLRGALFQRPPLISAVKRQLRVRTVYDSKLLDYDDQRNMGVFWVSCEAGSYIRTMCVHLGL

Caenorhabditis elegans          KTGHSGTLDPKVSGCLIVCIDRTTRLAKSQQGAGKEYICIFKLHEEVED-DRKVKQALEKLTGALFQRPPLISAVKRQLRIRTVYENKFIEYDPAQQMGIFNCICESGTYVRTICVHLGL

Schizosaccharomyces pombe       KTGHSGTLDPKVTGCLIICNDRATRLVKSQQSAGKEYVCVLRLHDSVEG-ERNVASAIETLTGALFQRPPLISAVKRQLRIRSIYESKLIEFDNERNLAVFWASCEAGTYMRTLCVHLGL

Saccharomyces cerevisiae        KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCIVRLHDALKD-EKDLGRSLENLTGALFQRPPLISAVKRQLRVRTIYESNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGM

Kluyveromyces lactis            KTGHSGTLDPKVTGCLIVCVDRATRLVKSQQGAGKEYVCIVRLHDALKD-EKELGRGLENLTGALFQRPPLISAVKRQLRVRTIYDSNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGM

Ashbya gossypii                 KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCIVRLHDALKD-EKDLGRELENLTGALFQRPPLISAVKRQLRVRTIYDSKLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGM

Lodderomyces elongisporus       KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCIVRLHDQLEE-PKELNRALENLTGALFQRPPLISAVKRQLRVRTVYDSKLIEFDNKRGLGVFWASCEAGTYMRTLCVHLGM

Pichia stipitis                 KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCIVRLHEELKD-AKDLGRSLENLTGALFQRPPLISAVKRQLRVRTIYDSNLIEFDNKRGLGVFWASCEAGTYMRTLCVHLGM

Pichia guilliermondii           KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCIVRLHDELKD-AKDMGRSLENLTGALFQRPPLISAVKRQLRVRTIYDSNLIEFDNKRGLGVFWASCEAGTYMRTLCVHLGM

Zygosaccharomyces rouxii        KTGHSGTLDPKVTGCLIVCVDRATRLVKSQQGAGKEYVCIVRLHDALKD-EKDLGRSLESLTGALFQRPPLISAVKRQLRVRTIYDSNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGM

Aspergillus fumigatus           KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKIPGGEAQFKRALETLTGALFQRPPLISAVKRQLRIRTIHESKLYEFDNDRHLGVFWVSCEAGTYIRTLCVHLGL

Aspergillus clavatus            KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKIPGGEAQFKRALETLTGALFQRPPLISAVKRQLRIRTIHESKLYEFDNERHLGVFWVSCEAGTYIRTLCVHLGL

Aspergillus nidulans            KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKIPGGEAQFKRALETLTGALFQRPPLISAVKRQLRIRTIHESKLYEFDNERHLGVFWVSCEAGTYIRTLCVHLGL

Chaetomium globosum             KTGHSGTLDPKVTGCLIVCIDRATRLVKAQQGAGKEYVAVVRFHDTIPGGEPAFAKALETLTGALFQRPPLISAVKRQLRIRTIHESKLIEFDNDRHLGVFWVSCEAGTYIRTLCVHLGL

Magnaporthe grisea              KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKVPGGEPEFARALETLTGALFQRPPLISAVKRQLRIRTIHESKLIEFDNDRHLGVFWVSCEAGTYIRTLCVHLGL

Neurospora crassa               KTGHSGTLDPKVTGCLIVCVDRATRLVKAQQGAGKEYVCVIRFHDSVPGGEAAFASALETLTGALFQRPPLISAVKRQLRIRSIYESKLIEFDNDRHLGVFWVSCEAGTYIRTLCVHLGL

Botryotinia fuckeliana          KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKLPGGEAQFARALETLTGALFQRPPLISAVKRQLRIRTIHESKLYEFDNDRHLGVFWVSCEAGTYIRTLCVHLGL

Pyrenophora tritici-repentis    KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKLPGGEAQFARALETLTGALFQRPPLISAVKRQLRIRTIHESKLYEFDNERQLGVFWVSCEAGTYIRTLCVHLGL

Neosartorya fischeri            KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKIPGGEAQFKRALETLTGALFQRPPLISAVKRQLRIRTIHESKLYEFDNDRHLGVFWVSCEAGTYIRTLCVHLGL

Coccidioides immitis            KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKIPGGEAQFARALETLTGALFQRPPLISAVKRQLRIRTIHESKLYEFDNDRHLGVFWVSCEAGTYIRTLCVHLGL

Dictyostelium discoideum        KTGHSGTLDPKVTGCLIVCIERATRLVKSQQGAGKEYIGIVRLHGAIEG-TTELSKAVDTLTGALFQRPPQKSAVKKRLRVRTIHNSKLLEFDPERNLGLIWVDCEAGTYIRTLCVHIGL

Arabidopsis thaliana            KTGHSGTLDPKVTGNLIVCIDRATRLVKSQQGAGKEYVCVARLHSAVP-DVAKVARALESLTGAVFQRPPLISAVKRQLRIRTIYESKLLEYDADRHLVVFWVSCEAGTYIRTMCVHLGL

Chlamydomonas reinhardtii       KTGHSGTLDPKVTGNLIVCIDRATRLVKAQQAAGKEYVCIARFHGKVEGGTAAVNKALETLTGALFQRPPLISAVKRQLRVRTIYQAKLYEYDEERHLAVFWISCEAGTYVRTLCVHLGL

Cryptosporidium parvum          KTGHSGTLDPKVTGCLLVCLNRATRLVKSQQSAGKEYVCIVRFHSSVGG-KSAVSRCLETLTGALFQRPPVISAVKRQLRVRSIYDSKLLDYDEKRNLAVFWAKCEAGTYIRTMCVHMGL

Euglena gracilis                KTGHAGTLDPKVTGSLLICIERATRLVKSQQNAGKEYVGVLRLHDALKD-EAQLLKALEDLTGAVFQRPPVVAAVKRTLRIRTIYESKLLDFDNDRHLAVFWISCEAGTYVRTLCVHLGF

Methanocaldococcus jannaschii   KAGHGGTLDPKVTGVLPVALERATKTIPMWHIPPKEYVCLMHLHRDASE--EDILRVFKEFTGRIYQRPPLKAAVKRRLRIRKIHELELLDKDGKD--VLFRVKCQSGTYIRKLCEDIGE

 

                                        250       260       270       280       290       300       310       320       330       340       350       360

                                ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|

                                                                                               |---------------------------------------PUA domain-------

Homo sapiens                    LLGVGGQMQELRRVRSGVMSEK--DHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRY---------EDGIEVNQEIVVITTKGEAIC

Rattus norvegicus               LLGVGGQMQELRRVRSGVVGER--DHMVTMHDVLDAQYLYDHHRDESYLRRVVFPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGLLRY---------EDGIEVNQEVVVITTKGEAVC

Mus musculus                    LLGVGGQMQELRRVRSGVMSEK--DHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGLLRY---------EDGIEVNQEIVVITTKGEAIC

Bos taurus                      LLGVGGQMQELRRVRSGVMSEK--DHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRY---------EDGIEVNQEIVVITTKGEAIC

Gallus gallus                   LLGVGGQMQELRRVRSGILGEM--DNMVTMHDVLDAQWQYDNNKDDSYLRRVILPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRY---------EDGIELKQEIVVITTKGEAIC

Danio rerio                     LLGVGGQMQELRRVRSGVLGEK--DNLVTMHDVLDAQWQFDHNKDETYLRRVIFPLEKLLISHKRIVMKDSAVNAICYGAKIMLPGVLRY---------EDGIEVNQDIVVITTKGEAIC

Drosophila melanogaster         VLGVGGQMLELRRVRSGIQSER--DGMVTMHDVLDAMWLYENHKDESMLRRVIKPLEGLLVNHKRIIMKDSSVNAVCYGAKITLPGVLRY---------EDGIEIDQEIVICTTKGEAIC

Anopheles gambiae               VLGVGGQMLELRRVRSGIQSEK--DGMVTMHDVLDAQYLYENHKDESMLRRVIKPLEGLLVGHKRIIMKDSSVNAVCYGAKILLPGVLRY---------EDGIEIDQEIVIVTTKGEAIA

Aedes aegypti                   VTGVGGQMLELRRVRSGIQSEK--DGMVTMHDVLDAQYLYDNHKDETMLRRVIKPLEGLLVGHKRIIMKDSSVNAVCYGAKIMLPGVLRY---------EDGIEMDQEIVIVTTKGEAVA

Culex pipiens quinquefasciatus  VTGVGGQMLELRRVRSGIQSEK--DGMVTMHDVLDAQYLYENHKDESMLRRVIKPLEGLLIGHKRIIMKDSSVNAVCYGAKIMIPGVLRY---------EDGIEVDQEIVIVTTKGEAIA

Caenorhabditis elegans          ILGCGGQMQELRRNRSGICDEN--ENMVTMHDVLDAQYLLDTQKDESYMRHIVRPLEALLTQHKRVVVKDSCINAICYGAKILIPGILRY---------DDDIEVGKEIVIMSTKGEAIC

Schizosaccharomyces pombe       LLGVGGHMQELRRVRSGCLSEN--DDIVTMHDVLDAQWIYDNTRDESYLRRVIRPLESLLVGYKRIVVKDSAVNAICYGAKLMIPGLLRY---------EAGIEVNEEIVLITTKGEAIA

Saccharomyces cerevisiae        LLGVGGHMQELRRVRSGALSEN--DNMVTLHDVMDAQWVYDNTRDESYLRSIIQPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRY---------EEGIELYDEIVLITTKGEAIA

Kluyveromyces lactis            LLGVGGHMQELRRVRSGALSEN--DNLVTLHDVMDAQWVYDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRY---------EEGIELYDEVVLITTKGEAIA

Ashbya gossypii                 LLGVGGHMQELRRVRSGALDEN--DNMVTLHDVLDAQWVYDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRY---------EEGIELYDEVVLITTKGEAIA

Lodderomyces elongisporus       LLGVGGHMQELRRVRSGAMSES--DNLVTLHDVLDAQYVYDNTRDESYLRKIIQPLETLLVGYKRLVVKDSAVNSVCYGAKLMLPGLLRY---------ESGIELYDEVVLITTKGEAIA

Pichia stipitis                 LLGVGGHMQELRRVRSGALGEN--DNLVTLHDVLDAQYVYDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVNSVCYGAKLMIPGLLRY---------EEGIELYDEVVLMTTKGEAIA

Pichia guilliermondii           LLGVGGHMQELRRVRSGALAEN--DNLVTLHDVLDAQYVYDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVNSVCYGAKLMIPGLLRY---------EEGIELYDEVVLITTKGEAIA

Zygosaccharomyces rouxii        LLGVGGHMQELRRVRSGALSEN--DNLVTLHDILDAQWVYDNTRDESYLRRVIQPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRY---------EDGIELYDEVVLITTKGEAIA

Aspergillus fumigatus           LLGVGAHMQELRRVRSGAMDEN--NGLVTLHDVLDAQWMYDNQRDESYLRRVIQPLESLLTTYKRIVVKDSAVNAVCYGAKLMIPGLLRF---------EAGIEVNEEVVLMTTKGEAIA

Aspergillus clavatus            LLGVGAHMQELRRVRSGAMDEN--NGLVTLHDVLDAQWMYDNQRDESYLRRVISPLESLLTTYKRIVVKDSAVNAVCYGAKLMIPGLLRF---------EAGIDVNEEVVLMTTKGEAIA

Aspergillus nidulans            LLGVGAHMQELRRVRSGAMSEN--EGMVTLHDVLDAQWLYDNQRDESYLRKVIKPLESLLTTYKRIVVKDSAVNAVCYGAKLMIPGLLRFGQKSLTWGLEAGIELGEEVVLMTTKGEAIA

Chaetomium globosum             LLGVGAHMQELRRVRSGVMSED-NGSLVTLHDVLDAQWQYDNGGDESYLRKVIQPLETLLCTYKRLVVKDSAVNAVCYGAKLMLPGLLRY---------DAGIDAHEEVVLMTTKGEAIA

Magnaporthe grisea              MLGVGAHMQELRRVRSGAMDET--KDLHTLHDVLDAQWLMDNTRDESYLRKVIQPLETLLTTYKRLVVKDSAVNAVCYGAKLMLPGLLRY---------EADIELHEEVVLMTTKGEAIA

Neurospora crassa               LLGVGAHMQELRRVRSGIMSED-NGSMVTLHDVLDAQWQFDNGGDETALRKVIQPLETLLTTYKRIVVKDSAVNAVCYGAKLMLPGLLRF---------EKGIETHEEVVLMTTKGEAIA

Botryotinia fuckeliana          LLGVGAHMQELRRVRSGAMDET--KDMVTLHDVLDAQWMQDNARDEAYLRKVIQPLETLLTTYKRIVVKDSAVNAVCYGAKLMIPGLLRY---------EADIEVHEEVVLMTTKGEAIA

Pyrenophora tritici-repentis    LLGVGAHMQELRRVRSGAMDET--KDLVTLHDVLDAQWLHDNNRDEAYLRKVIAPLESLLMSYKRIVVKDSSVNAICYGAKLMLPGLLRF---------EKGIEIHEEVVLMTTKGEAIA

Neosartorya fischeri            LLGVGAHMQELRRVRSGAMDEN--NGLVTLHDVLDAQWMYDNQRDESYLRRVIRPLESLLTTYKRIVVKDSAVNAVCYGAKLMIPGLLRF---------EAGIDVNEEVVLMTTKGEAIA

Coccidioides immitis            LLGVGAHMQELRRVRSGAMDEQ--DGMVTLHDVLDAQWMMDNNRDESYLRRVVRPLETLLTTYKRVVVKDSAVNAVCYGAKLMIPGLLRF---------EAGIEVHEEVVLMTTKGEAIA

Dictyostelium discoideum        LMGVGGHMQEL